Property Summary

Ligand Count 16
NCBI Gene PubMed Count 12
PubMed Score 26.25
PubTator Score 14.74

Knowledge Summary

Patent (10,046)

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.548 3.9e-04
astrocytoma 1.600 3.9e-02
Astrocytoma, Pilocytic 1.800 6.2e-05
Breast cancer -1.700 1.8e-13
group 3 medulloblastoma -1.300 4.8e-02
head and neck cancer and chronic obstruc... 1.400 7.3e-04
hepatocellular carcinoma 1.600 5.2e-04
interstitial cystitis 1.400 1.4e-02
invasive ductal carcinoma -1.200 2.5e-02
lung adenocarcinoma -1.029 1.8e-04
lung cancer -1.400 2.1e-03
lung carcinoma -1.900 8.7e-20
mucosa-associated lymphoid tissue lympho... 2.291 1.3e-02
non-small cell lung cancer -1.663 6.2e-15
osteosarcoma -3.723 1.3e-03
pancreatic cancer 1.300 2.7e-02
pancreatic carcinoma 1.300 2.7e-02
pituitary cancer 1.800 7.1e-06
primary Sjogren syndrome 1.200 4.6e-03
subependymal giant cell astrocytoma 1.935 3.6e-02
tuberculosis 3.800 4.1e-06
ulcerative colitis 1.900 1.9e-04

Gene RIF (4)

AA Sequence

MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFV      1 - 70
HIPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSVIFYETMYVGIVLLGLIAFD     71 - 140
RFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTILSNKEATPSSVKKCASLKGPLGLKWHQMVN    141 - 210
NICQFIFWTVFILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTH    211 - 280
SQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDN    281 - 350
ITLG                                                                      351 - 354
//

Text Mined References (15)

PMID Year Title