Property Summary

Ligand Count 644
NCBI Gene PubMed Count 185
PubMed Score 1507.38
PubTator Score 1218.96

Knowledge Summary

Patent (11,245)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
platelet-type bleeding disorder 8 3

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.143 5.0e-04
Astrocytoma, Pilocytic 1.200 2.7e-02
atypical teratoid / rhabdoid tumor -2.900 3.5e-06
Breast cancer -2.600 7.3e-38
ductal carcinoma in situ -1.100 9.2e-04
gastric cancer 2.000 5.5e-03
glioblastoma multiforme -1.600 1.3e-09
group 3 medulloblastoma -2.400 8.1e-03
head and neck cancer and chronic obstruc... 1.600 1.6e-04
hepatocellular carcinoma 1.200 1.7e-03
intraductal papillary-mucinous carcinoma... -1.500 3.3e-02
invasive ductal carcinoma -1.200 4.9e-03
medulloblastoma, large-cell -3.000 3.3e-06
mucosa-associated lymphoid tissue lympho... 1.899 1.3e-02
non-small cell lung cancer -1.192 2.8e-15
oligodendroglioma -1.200 6.5e-05
pancreatic cancer 1.300 6.6e-03
pancreatic carcinoma 1.300 6.6e-03
pituitary cancer 1.900 4.4e-04
primary Sjogren syndrome 1.400 2.9e-03
primitive neuroectodermal tumor -1.900 3.7e-03
sarcoidosis 1.500 3.3e-02
tuberculosis 1.200 1.6e-02

Gene RIF (183)

AA Sequence

MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD      1 - 70
LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG     71 - 140
AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT    141 - 210
LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK    211 - 280
ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM            281 - 342
//

Text Mined References (185)

PMID Year Title