Property Summary

Ligand Count 1,410
NCBI Gene PubMed Count 354
PubMed Score 962.24
PubTator Score 787.14

Knowledge Summary

Patent (39,113)

Expression

  Differential Expression (18)

Gene RIF (370)

AA Sequence

MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE      1 - 70
VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWM     71 - 140
DPQSKGIQTGRCVVYEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILP    141 - 210
GLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDD    211 - 280
KTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVF    281 - 350
IDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRS    351 - 420
LQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPES    421 - 490
HRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGS    491 - 560
QDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY                                       561 - 595
//

Text Mined References (357)

PMID Year Title