Property Summary

NCBI Gene PubMed Count 320
PubMed Score 866.69
PubTator Score 787.14

Knowledge Summary

Patent (39,113)



  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Susumu Tomita Examining potential modulators

Gene RIF (336)

27038372 This chapter describes structural features of P2X7, chemical properties of its agonist, antagonist, and allosteric modulators and summarizes recent advances on P2X7 receptor as therapeutic target in the aforementioned diseases
27020872 A significant association of IFN-gammaR1 and P2X7 genes polymorphisms with risk of developing TB in Iranian population.
26951799 signaling through purinergic receptors, particularly P2X7R, drives an adaptive Th17 response in human visceral adipose tissue underlying the metabolic changes in obesity.
26877061 Neutrophils express functional cell-surface P2X7R, which leads to ATP-induced loss of intracellular K(+), NLRP3 inflammasome activation and IL-1beta secretion.
26825304 The association between independent P2X7R polymorphisms with stress fracture prevalence supports the role of a genetic predisposition in the development of stress fracture
26798189 P2X7 SNPs, 1513A>C and -762T>C, may be associated with the susceptibility to tuberculosis.
26687764 these data indicate that activation of EGFR enhanced the expression of P2X7R in neuroblastoma cells lacking trophic support, being PI3K/Akt/PKC signaling pathway and Sp1 mediating this pro-survival outcome
26683661 that P2X7 plays a critical role in mediating calcium signaling and coordinating cytoskeletal rearrangement
26671983 Increased expression of P2X7R levels were found in the cerebral cortex of patients with focal cortical dysplasia.
26607222 pancreatic ductal adenocarcinoma cell lines overexpress P2X7R and the receptor plays crucial roles in cell survival, migration and invasion.

AA Sequence

QDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY                                       561 - 595

Text Mined References (322)

PMID Year Title
27038372 2016 P2X7 Receptor as a Therapeutic Target.
27020872 2016 Association of IFN-? and P2X7 Receptor Gene Polymorphisms in Susceptibility to Tuberculosis Among Iranian Patients.
26951799 2016 ATP-Induced Inflammation Drives Tissue-Resident Th17 Cells in Metabolically Unhealthy Obesity.
26877061 2016 Neutrophil P2X7 receptors mediate NLRP3 inflammasome-dependent IL-1? secretion in response to ATP.
26825304 2016 Functional polymorphisms in the P2X7 receptor gene are associated with stress fracture injury.
26798189 2015 Single Nucleotide Polymorphisms in P2X7 Gene Are Associated with Serum Immunoglobulin G Responses to Mycobacterium tuberculosis in Tuberculosis Patients.
26687764 2015 PI3K/Akt signaling pathway triggers P2X7 receptor expression as a pro-survival factor of neuroblastoma cells under limiting growth conditions.
26683661 2016 Purinoreceptor P2X7 Regulation of Ca(2+) Mobilization and Cytoskeletal Rearrangement Is Required for Corneal Reepithelialization after Injury.
26671983 2016 Increased Expression and Cellular Localization of P2X7R in Cortical Lesions of Patients With Focal Cortical Dysplasia.
26607222 2015 The P2X7 receptor regulates cell survival, migration and invasion of pancreatic ductal adenocarcinoma cells.