Property Summary

NCBI Gene PubMed Count 24
PubMed Score 34.92
PubTator Score 32.58

Knowledge Summary

Patent (7,101)

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphocytic leukemia -2.229 2.0e-07
astrocytic glioma -1.400 2.3e-03
posterior fossa group B ependymoma -1.800 3.9e-15
oligodendroglioma -1.500 2.9e-03
cutaneous lupus erythematosus 2.600 6.1e-03
osteosarcoma -4.705 1.3e-09
group 3 medulloblastoma -1.900 6.0e-06
atypical teratoid / rhabdoid tumor -1.500 5.3e-07
glioblastoma -1.200 9.5e-05
lung cancer 1.600 2.5e-03
interstitial cystitis 2.900 1.3e-03
pilocytic astrocytoma -1.600 2.2e-08
primary Sjogren syndrome 1.900 4.3e-04
nasopharyngeal carcinoma -1.300 2.4e-03
ulcerative colitis 1.700 3.9e-03
psoriasis 1.100 6.4e-08

Gene RIF (13)

PMID Text
25181038 These data indicate a functional role of the human P2RX5 splice variant in T cell activation and immunoregulation.
25080478 The amino acid transporter PAT2 and the purinergic receptor P2RX5 are cell surface markers expressed in classical brown and beige adipocytes.
24868547 sensory proteins P2X3 and TRPV1 are in correlation with urothelial differentiation, while P2X5 and TRPV4 have unique expression patterns
21092862 Purinergic receptor P2X5 binds to adenosine triphosphate (ATP) to form a molecular complex with ASIC3 (acid-sensing ion channel number 3) to detect muscle ischemia.
20223879 findings indicate that most humans express only a nonfunctional isoform of P2X5, which is in stark contrast to what is seen in other vertebrate species in which P2X5 has been studied, from which only the full-length isoform is known
19074734 These findings provide a rationale for use of LRH-1 as immunotherapeutic target antigen to treat residual or persisting myeloid malignancies after allogeneic stem cell transplantation
18976975 Knockdown of purinergic receptor P2X, ligand-gated ion channel, 5 (P2RX5) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18719914 LRH-1 is aberrantly expressed on solid tumor cells
17001079 analysis of topology, helix-helix interactions, and oligomerization of P2X5 subunits
16967306 Increased keratinocyte P2X(5) receptor activity may, in part, be accountable for epidermal thinning in chronic venous insufficiency.
16322791 a P2X5 frameshift mutation has a role in response to treatment of chronic myeloid leukemia
12880424 Non-melanoma skin cancers express functional purinergic receptors and that P2X7 receptor agonists significantly reduce cell numbers in vitro.
12787128 Different purinergic receptors have different functional roles in human epidermis with P2Y1 and P2Y2 receptors controlling proliferation, while P2X5 and P2X7 receptors control early differentiation, terminal differentiation and death of keratinocytes.

AA Sequence

MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKV      1 - 70
KGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEA     71 - 140
VTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMD    141 - 210
VKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSR    211 - 280
LDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKK    281 - 350
YEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKRGSSSQKGNGSVCPQLLEPHR    351 - 420
ST                                                                        421 - 422
//

Text Mined References (26)

PMID Year Title
25181038 2014 A truncation variant of the cation channel P2RX5 is upregulated during T cell activation.
25080478 2014 ASC-1, PAT2, and P2RX5 are cell surface markers for white, beige, and brown adipocytes.
24868547 2014 Correlation between urothelial differentiation and sensory proteins P2X3, P2X5, TRPV1, and TRPV4 in normal urothelium and papillary carcinoma of human bladder.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21092862 2010 Sensing muscle ischemia: coincident detection of acid and ATP via interplay of two ion channels.
20962269 2011 P2Y1 and P2Y13 purinergic receptors mediate Ca2+ signaling and proliferative responses in pulmonary artery vasa vasorum endothelial cells.
20223879 2010 Genetic and functional analysis of human P2X5 reveals a distinct pattern of exon 10 polymorphism with predominant expression of the nonfunctional receptor isoform.
19074734 2009 Myeloid leukemic progenitor cells can be specifically targeted by minor histocompatibility antigen LRH-1-reactive cytotoxic T cells.
18719914 2009 Aberrant expression of the hematopoietic-restricted minor histocompatibility antigen LRH-1 on solid tumors results in efficient cytotoxic T cell-mediated lysis.
17895406 2007 Go it alone no more--P2X7 joins the society of heteromeric ATP-gated receptor channels.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17001079 2006 P2X5 subunit assembly requires scaffolding by the second transmembrane domain and a conserved aspartate.
16967306 2006 Purinoceptor expression on keratinocytes reflects their function on the epidermis during chronic venous insufficiency.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16322791 2005 A frameshift polymorphism in P2X5 elicits an allogeneic cytotoxic T lymphocyte response associated with remission of chronic myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12880424 2003 Expression of purinergic receptors in non-melanoma skin cancers and their functional roles in A431 cells.
12787128 2003 Purinergic receptors are part of a functional signaling system for proliferation and differentiation of human epidermal keratinocytes.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270951 2002 Molecular physiology of P2X receptors.
10673275 2000 The genomic region encompassing the nephropathic cystinosis gene (CTNS): complete sequencing of a 200-kb segment and discovery of a novel gene within the common cystinosis-causing deletion.
9414125 1997 Primary structure and expression of a naturally truncated human P2X ATP receptor subunit from brain and immune system.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.