Property Summary

Ligand Count 10
NCBI Gene PubMed Count 70
PubMed Score 314.76
PubTator Score 136.93

Knowledge Summary

Patent (21,420)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.200 2.5e-02
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma 1.100 2.9e-02
intraductal papillary-mucinous neoplasm ... -1.200 5.5e-03
malignant mesothelioma 1.200 4.2e-05
ulcerative colitis -1.300 5.5e-06

Gene RIF (52)

AA Sequence

MAGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKG      1 - 70
VAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTH     71 - 140
SNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNIT    141 - 210
TTYLKSCIYDAKTDPFCPIFRLGKIVENAGHSFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLD    211 - 280
TRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMAT    281 - 350
VLCDIIVLYCMKKRLYYREKKYKYVEDYEQGLASELDQ                                    351 - 388
//

Text Mined References (74)

PMID Year Title