Property Summary

NCBI Gene PubMed Count 39
PubMed Score 300.72
PubTator Score 124.71

Knowledge Summary

Patent (3,808)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.200 2.4e-17

Gene RIF (26)

AA Sequence

MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES      1 - 70
ETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDA     71 - 140
DCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIKNSIHYPKFHF    141 - 210
SKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECN    211 - 280
PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT    281 - 350
SVGVGSFLCDWILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG    351 - 420
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL                       421 - 471
//

Text Mined References (39)

PMID Year Title