Property Summary

Ligand Count 14
NCBI Gene PubMed Count 69
PubMed Score 259.41
PubTator Score 187.38

Knowledge Summary

Patent (17,609)

Expression

Gene RIF (55)

AA Sequence

MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLK      1 - 70
GLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRK     71 - 140
AQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVN    141 - 210
AAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLY    211 - 280
EEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCD    281 - 350
LLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS                         351 - 399
//

Text Mined References (69)

PMID Year Title