Property Summary

NCBI Gene PubMed Count 97
PubMed Score 555.13
PubTator Score 83.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Heart Defects, Congenital 37 0.0 0.0
Melanoma 711 0.0 1.9
Uveal melanoma 20 0.0 0.0
Disease Target Count Z-score Confidence
DOID:2415 5 0.0 0.5
Ocular cancer 7 0.0 1.9
Skin cancer 469 0.0 0.7

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-03
astrocytoma 1.200 1.2e-02
atypical teratoid / rhabdoid tumor -1.400 5.5e-06
colon cancer -1.100 1.2e-02
medulloblastoma, large-cell -1.200 2.2e-05
osteosarcoma 2.829 2.0e-05
ovarian cancer -1.400 4.0e-06
primitive neuroectodermal tumor -1.100 2.0e-03
psoriasis -1.100 2.5e-07
spina bifida -1.004 3.9e-02
subependymal giant cell astrocytoma -1.610 2.1e-02
ulcerative colitis -1.400 1.1e-05

Gene RIF (59)

AA Sequence

MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE      1 - 70
DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG     71 - 140
IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR    141 - 210
SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE    211 - 280
DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ    281 - 350
LNLKEYNLV                                                                 351 - 359
//

Text Mined References (103)

PMID Year Title