Property Summary

NCBI Gene PubMed Count 267
Grant Count 222
R01 Count 140
Funding $30,290,630.35
PubMed Score 1040.51
PubTator Score 1078.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29972 B5BU39 E7EM69 E9PC21 F5GY19 Q8TBI5 Q8TDC1 AQP-1
Symbols CO
CHIP28
AQP-CHIP

Gene

PANTHER Protein Class (1)

PDB

1FQY   1H6I   1IH5   4CSK  

Protein-protein Interaction (16)

Gene RIF (168)

PMID Text
27295912 Urinary AQP1 is significantly lower in patients with clear cell renal carcinoma than in controls. Urinary AQP1 increases after nephrectomy in clear cell renal carcinoma patients.
26823734 Suggest that sputum AQP1 and AQP5 could be used as diagnostic markers in mild-to-moderate adult-onset asthma.
26786101 Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family.
26773069 The role of AQP1 in malignant pleural mesothelioma.
26717516 These data provide support for a continuous role of KLF2 in stabilizing the vessel wall via co-temporal expression of eNOS and AQP1 both preceding and during the pathogenesis of atherosclerosis.
26549133 the downregulation of AQP1 impedes extracellular to intracellular fluid transportation.
26261083 The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease.
26181025 Results demonstrate the clinical utility, specificity, and sensitivity of urine AQP1 and PLIN2 to diagnose renal cell carcinoma.
26178576 PBEF regulates the expression of inflammatory factors and AQP1 through the MAPK pathways.
26176849 AQP1 knockdown can effectively inhibit cell proliferation, adhesion, invasion and tumorigenesis by targeting TGF-beta signaling pathway and focal adhesion genes.
More...

AA Sequence

MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHI      1 - 70
SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG     71 - 140
IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW    141 - 210
IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK               211 - 269
//

Publication (269)

PMID Year Title
27295912 2016 Urinary KIM-1 and AQP-1 in patients with clear renal cell carcinoma: Potential noninvasive biomarkers.
26823734 2015 Use of aquaporins 1 and 5 levels as a diagnostic marker in mild-to-moderate adult-onset asthma.
26786101 2016 Structural Determinants of Oligomerization of the Aquaporin-4 Channel.
26773069 2016 Influence of AQP1 on cell adhesion, migration, and tumor sphere formation in malignant pleural mesothelioma is substratum- and histological-type dependent.
26717516 2015 Expression of Nitric Oxide-Transporting Aquaporin-1 Is Controlled by KLF2 and Marks Non-Activated Endothelium In Vivo.
26549133 2016 Inhibition of the expression of aquaporin?1 by RNA interference in pulmonary epithelial cells and its effects on water transport.
26261083 2015 Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema.
26181025 2015 Evaluation of Urine Aquaporin-1 and Perilipin-2 Concentrations as Biomarkers to Screen for Renal Cell Carcinoma: A Prospective Cohort Study.
26178576 2015 PBEF promotes the apoptosis of pulmonary microvascular endothelial cells and regulates the expression of inflammatory factors and AQP1 through the MAPK pathways.
26176849 2015 RNAi-mediated silencing of AQP1 expression inhibited the proliferation, invasion and tumorigenesis of osteosarcoma cells.
More...