Property Summary

NCBI Gene PubMed Count 284
PubMed Score 1107.39
PubTator Score 1078.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (28)

Disease log2 FC p
adult high grade glioma 2.600 8.1e-04
astrocytic glioma 1.500 2.4e-02
Astrocytoma, Pilocytic 1.400 2.6e-02
breast carcinoma -1.700 1.9e-04
Down syndrome 1.400 4.3e-03
ductal carcinoma in situ -1.400 2.3e-03
ependymoma 2.700 1.5e-04
gastric carcinoma 1.900 2.6e-02
glioblastoma 1.600 3.5e-03
inflammatory breast cancer -1.500 4.5e-02
interstitial cystitis 1.400 1.3e-03
intraductal papillary-mucinous adenoma (... -2.200 7.8e-06
intraductal papillary-mucinous carcinoma... -1.900 3.4e-04
intraductal papillary-mucinous neoplasm ... -1.900 8.8e-04
invasive ductal carcinoma -2.100 1.2e-03
lung adenocarcinoma -2.000 3.9e-11
lung cancer -2.400 4.5e-04
lung carcinoma -2.500 3.3e-18
mucosa-associated lymphoid tissue lympho... 1.728 1.3e-02
non-small cell lung cancer -2.457 3.1e-19
osteosarcoma -2.075 2.8e-02
ovarian cancer -1.900 7.8e-13
pancreatic cancer -1.100 6.3e-03
primary pancreatic ductal adenocarcinoma -1.127 3.5e-02
psoriasis -2.100 9.7e-04
pterygium 2.100 1.5e-04
subependymal giant cell astrocytoma -2.023 3.9e-03
urothelial carcinoma 1.700 1.8e-03

Gene RIF (182)

AA Sequence

MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHI      1 - 70
SGAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLG     71 - 140
IEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHW    141 - 210
IFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK               211 - 269
//

Text Mined References (286)

PMID Year Title