Property Summary

NCBI Gene PubMed Count 17
PubMed Score 13.86
PubTator Score 10.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MLAAFISRVLRRVAQKSARRVLVASRNSSNDATFEIKKCDLYLLEEGPPVTTVLTRAEGLKYYRMMLTVR      1 - 70
RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHGVCYTRGLSVRSILAELTGRR     71 - 140
GGCAKGKGGSMHMYTKNFYGGNGIVGAQGPLGAGIALACKYKGNDEICLTLYGDGAANQGQIAEAFNMAA    141 - 210
LWKLPCVFICENNLYGMGTSTERAAASPDYYKRGNFIPGLKVDGMDVLCVREATKFAANYCRSGKGPILM    211 - 280
ELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLATVEELKEIGAEVRKEIDDAAQF    281 - 350
ATTDPEPHLEELGHHIYSSDSSFEVRGANPWIKFKSVS                                    351 - 388
//

Text Mined References (20)

PMID Year Title