Property Summary

NCBI Gene PubMed Count 32
Grant Count 43
R01 Count 39
Funding $4,251,943.87
PubMed Score 302.50
PubTator Score 167.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -2.300 0.000
oligodendroglioma -1.200 0.018
psoriasis -3.100 0.001
glioblastoma -1.900 0.000
group 3 medulloblastoma -2.100 0.008
fibroadenoma 1.900 0.032
pediatric high grade glioma -1.600 0.021
pilocytic astrocytoma -2.700 0.000
invasive ductal carcinoma -2.457 0.000
non-inflammatory breast cancer -2.700 0.003
pituitary cancer 1.700 0.006

Gene RIF (21)

PMID Text
26142905 CRABP1 expression is maintained in ER- and triple-negative breast tumors, and that elevated levels of CRABP1 is a significant indicator of high tumor grade, Ki67 immunoreactivity, and poor prognosis.
26124181 miR-93/miR-106b/miR-375-CIC-CRABP1 is a novel key regulatory axis in prostate cancer progression
25034531 we demonstrated significant changes in CRABP1 and CRABP2 expression in non-small cell lung cancer samples
24626200 the first evidence of pro-tumorigenic and pro-metastatic activity of CRABP1 in mesenchymal and neuroendocrine tumors.
24269351 Factors involved in the retinoid pathway, in particular upregulation of CRBP, CRABP1 and CRABP2, also showed differential expression in tumors with different histological subtypes
21270509 Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20571834 Observational study of gene-disease association. (HuGE Navigator)
20571827 reduced expression of CRABP1 has a potential as a prognostic marker for serous adenocarcinoma which is the most frequent histological ovarian tumor type and also for clear cell carcinoma that often exhibits chemo-resistance.
19087254 The authors identified several dysregulated genes and proteins, but only the cellular retinoic acid binding protein 1 (CRABP1) was up-regulated exclusively in cells expressing an increased Abeta42/Abeta40 ratio.
More...

AA Sequence

MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGE      1 - 70
GFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE        71 - 137
//

Text Mined References (33)

PMID Year Title
26142905 2015 CRABP1 is associated with a poor prognosis in breast cancer: adding to the complexity of breast cancer cell response to retinoic acid.
26124181 2015 miR-93/miR-106b/miR-375-CIC-CRABP1: a novel regulatory axis in prostate cancer progression.
25034531 2014 Expression and clinical significance of CRABP1 and CRABP2 in non-small cell lung cancer.
24626200 2014 CRABP1 provides high malignancy of transformed mesenchymal cells and contributes to the pathogenesis of mesenchymal and neuroendocrine tumors.
24269351 2014 Proteome analysis of the effects of all-trans retinoic acid on human germ cell tumor cell lines.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21270509 2011 Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20571834 2010 Polymorphisms in TGFB1 and PDGFRB are associated with Moyamoya disease in European patients.
20571827 2011 CRABP1-reduced expression is associated with poorer prognosis in serous and clear cell ovarian adenocarcinoma.
More...