Property Summary

NCBI Gene PubMed Count 33
PubMed Score 20.84
PubTator Score 18.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Influenza, Human 51 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease 1.345 4.3e-03
active ulcerative colitis 1.385 6.3e-03
adult high grade glioma 1.800 2.6e-04
Astrocytoma, Pilocytic 1.200 1.1e-03
Atopic dermatitis 1.600 2.3e-04
atypical teratoid / rhabdoid tumor 1.900 2.4e-04
Breast cancer 1.500 4.8e-05
breast carcinoma 1.700 3.6e-30
cutaneous lupus erythematosus 4.100 4.4e-06
cystic fibrosis 1.887 2.2e-03
glioblastoma 1.300 4.7e-05
head and neck cancer 1.200 2.5e-02
interstitial cystitis 1.100 1.5e-02
intraductal papillary-mucinous adenoma (... 1.200 1.4e-04
intraductal papillary-mucinous carcinoma... 1.200 4.8e-03
intraductal papillary-mucinous neoplasm ... 2.400 9.8e-04
invasive ductal carcinoma 1.207 2.5e-02
juvenile dermatomyositis 2.359 1.7e-13
lung cancer -2.500 2.0e-05
lung carcinoma -2.400 3.1e-21
malignant mesothelioma 4.400 1.9e-08
medulloblastoma 1.100 1.7e-03
medulloblastoma, large-cell 1.300 7.3e-04
Multiple Sclerosis 2.500 6.9e-03
osteosarcoma -1.384 8.2e-03
pancreatic cancer 1.600 2.1e-04
posterior fossa group A ependymoma 1.200 9.7e-03
primary Sjogren syndrome 1.200 1.1e-04
primitive neuroectodermal tumor 1.400 1.6e-02
psoriasis 3.100 1.5e-08
Systemic lupus erythematosus 1.300 1.5e-03
tuberculosis 1.300 4.0e-02

Gene RIF (15)

AA Sequence

MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLR      1 - 70
GNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISF     71 - 140
EVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQC    141 - 210
QKKIKDLPSLSPYALELLTVYAWEQGCRKDNFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNIL    211 - 280
LHQLQSARPVILDPVDPTNNVSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDK    281 - 350
FIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS    351 - 420
YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALG    421 - 490
QLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPK    491 - 560
GSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQK    561 - 630
TRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVN    631 - 700
EMFSSRSHRILNNNSKRNF                                                       701 - 719
//

Text Mined References (40)

PMID Year Title