Property Summary

NCBI Gene PubMed Count 32
PubMed Score 16.67
PubTator Score 18.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Influenza 142
Disease Target Count P-value
psoriasis 6685 5.13444070737084E-169
breast carcinoma 1614 3.61743749370055E-30
lung carcinoma 2844 3.05771059501169E-21
juvenile dermatomyositis 1189 1.7151894191984E-13
malignant mesothelioma 3163 1.94343047220721E-8
ulcerative colitis 2087 3.91195779097886E-6
cutaneous lupus erythematosus 1056 4.39094856176773E-6
lung cancer 4473 6.48986400493549E-6
Breast cancer 3099 4.82449025734191E-5
primary Sjogren syndrome 789 1.14819096356481E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.43783109546321E-4
pancreatic cancer 2300 2.13362052697847E-4
Atopic dermatitis 944 2.30586675811817E-4
atypical teratoid / rhabdoid tumor 4369 2.44199226730883E-4
glioblastoma 5572 4.47375602656421E-4
pediatric high grade glioma 2712 5.16495008507393E-4
tuberculosis 1563 5.47427741336107E-4
medulloblastoma, large-cell 6234 7.33428607898563E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.75533106046744E-4
systemic lupus erythematosus 172 0.00152667287843145
pilocytic astrocytoma 3086 0.00170903238724961
medulloblastoma 1524 0.00173472548759078
cystic fibrosis 1670 0.00200569864120408
posterior fossa group B ependymoma 1530 0.00277458666488213
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00481812031622935
active Crohn's disease 918 0.0056825377671434
Multiple Sclerosis 498 0.006876728368424
invasive ductal carcinoma 2950 0.00722363410234873
osteosarcoma 7933 0.0081829423966604
interstitial cystitis 2299 0.0153437236465823
primitive neuroectodermal tumor 3031 0.016334301966423
head and neck cancer 270 0.0253190712536107

Expression

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (14)

PMID Text
26595239 Suggest 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-zeta chain down-regulation via caspase-3 activation in oral cancer.
26116899 HIV-1 Vpr upregulates the gene expression of OAS2 in human monocyte-derived dendritic cells
24742347 HIV-1 Vpr upregulates the gene expression of OAS2 in human monocyte-derived dendritic cells
24594345 Data obtained suggest that the OAS2 rs1293762 and CD209 rs2287886 SNPs are associated with predisposition to chronic hepatitis C in Russian population.
24328427 Primary mononuclear cells from patients with systemic sclerosis have increased basal levels of OASL and OAS2 genes.
23337612 The results suggest that OAS1-OAS3-OAS2 haplotypes are associated with differential susceptibility to clinical outcomes of dengue infection.
21050126 The data suggest a possible association between OAS2 and OAS3 single nucleotide polymorphisms and the outcome of tick-borne encephalitis virus infection in a Russian population.
21050126 Observational study of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
19853919 2'-5'-oligoadenylate synthetase type 2 (OAS2), a dsRNA binding protein involved in the pathway that activates RNase-L, is identified as a new binding partner for NOD2.
More...

AA Sequence

MGNGESQLSSVPAQKLGWFIQEYLKPYEECQTLIDEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLR      1 - 70
GNSDGTLVLFFSDLKQFQDQKRSQRDILDKTGDKLKFCLFTKWLKNNFEIQKSLDGFTIQVFTKNQRISF     71 - 140
EVLAAFNALSLNDNPSPWIYRELKRSLDKTNASPGEFAVCFTELQQKFFDNRPGKLKDLILLIKHWHQQC    141 - 210
QKKIKDLPSLSPYALELLTVYAWEQGCRKDNFDIAEGVRTVLELIKCQEKLCIYWMVNYNFEDETIRNIL    211 - 280
LHQLQSARPVILDPVDPTNNVSGDKICWQWLKKEAQTWLTSPNLDNELPAPSWNVLPAPLFTTPGHLLDK    281 - 350
FIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKS    351 - 420
YTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALG    421 - 490
QLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPK    491 - 560
GSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQK    561 - 630
TRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPTMQTPGSCGARIHPIVN    631 - 700
EMFSSRSHRILNNNSKRNF                                                       701 - 719
//

Text Mined References (39)

PMID Year Title
26595239 2016 Extracellular 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-? chain down-regulation via caspase-3 activation in oral cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24594345 2014 Association between polymorphisms in OAS2 and CD209 genes and predisposition to chronic hepatitis C in Russian population.
24328427 2014 Differential upregulation of human 2'5'OAS genes on systemic sclerosis: Detection of increased basal levels of OASL and OAS2 genes through a qPCR based assay.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23337612 2013 Polymorphisms in the oligoadenylate synthetase gene cluster and its association with clinical outcomes of dengue virus infection.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21269460 2011 Initial characterization of the human central proteome.
21142819 2011 The oligoadenylate synthetase family: an ancient protein family with multiple antiviral activities.
More...