Property Summary

NCBI Gene PubMed Count 52
PubMed Score 28.46
PubTator Score 35.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 3.59112365427343E-32
astrocytoma 1493 3.941841637266E-26
oligodendroglioma 2849 3.61476361973281E-15
posterior fossa group A ependymoma 1511 5.32461880153525E-9
sonic hedgehog group medulloblastoma 1482 2.75703573314862E-5
osteosarcoma 7933 4.18826455169448E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.09442053566622E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 7.16309716629635E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00183870890393839
Multiple myeloma 1328 0.00556074765260333
lung cancer 4473 0.0412317256324854

Expression

Synonym

Accession P29692 B4DDU4 D3DWK3 E9PBQ9 Q4VBZ6 Q969J1 Q96I38 EF-1-delta
Symbols EF1D
EF-1D
FP1047

Gene

PDB

2MVM   2MVN   2N51  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (12)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22721673 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21936567 our results demonstrate that EEF1D is a bona fide physiological CK2 substrate for CK2 phosphorylation
21633900 Taken together, our data suggest EFF1D functions as a novel negative regulator of SIAH-1
20514991 overexpression is positively correlated with malignant transformation of 16HBE cells induced by CdC12, but is not correlated with DNA mutations
19454010 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17997862 Repression of deltaEF1 plays a key role in mediating BMP-6-induced transcriptional activation of E-cadherin in breast cancer cells.
16968546 Gain of 8q-mapped EF-1 delta is associated with adverse outcome in Medulloblastoma.
15199388 Increased EF-1 delta mRNA expression is associated with lymph node metastases and advanced disease stages in esophageal carcinoma
15062873 Interaction between HrHRF and EF-1delta taken with some of the recently published information concerning the TCTP (HrHRF) mentioned above suggest a possible intracellular role for TCTP/HrHRF.
12210501 These results further confirm that overexpression of TEF-1 delta is oncogenic and the antisense TEF-1 delta mRNA expression reverses its oncogenic potential.
9514931 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells

AA Sequence

MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGAS      1 - 70
SGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEP     71 - 140
PAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETD    141 - 210
MAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK    211 - 280
I//

Text Mined References (72)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21936567 2011 Unbiased functional proteomics strategy for protein kinase inhibitor validation and identification of bona fide protein kinase substrates: application to identification of EEF1D as a substrate for CK2.
21633900 2011 Eukaryotic translation elongation factor 1 delta inhibits the ubiquitin ligase activity of SIAH-1.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21597468 2011 Transformation of eEF1B? into heat-shock response transcription factor by alternative splicing.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20514991 2010 Alternative expression and sequence of human elongation factor-1 delta during malignant transformation of human bronchial epithelial cells induced by cadmium chloride.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17997862 2007 BMP-6 promotes E-cadherin expression through repressing deltaEF1 in breast cancer cells.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16968546 2006 Medulloblastoma outcome is adversely associated with overexpression of EEF1D, RPL30, and RPS20 on the long arm of chromosome 8.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199388 2004 Clinical significance of elongation factor-1 delta mRNA expression in oesophageal carcinoma.
15189156 2004 The molecular mechanics of eukaryotic translation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15062873 2004 Identification of the interaction between the human recombinant histamine releasing factor/translationally controlled tumor protein and elongation factor-1 delta (also known as eElongation factor-1B beta).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623968 2003 Translationally controlled tumor protein acts as a guanine nucleotide dissociation inhibitor on the translation elongation factor eEF1A.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12773547 2003 Kinectin anchors the translation elongation factor-1 delta to the endoplasmic reticulum.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12551973 2003 Conserved protein kinases encoded by herpesviruses and cellular protein kinase cdc2 target the same phosphorylation site in eukaryotic elongation factor 1delta.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12210501 2002 Blocking the translation elongation factor-1 delta with its antisense mRNA results in a significant reversal of its oncogenic potential.
11829477 2002 Interaction network of human aminoacyl-tRNA synthetases and subunits of elongation factor 1 complex.
10567582 1999 Identification of CtBP1 and CtBP2 as corepressors of zinc finger-homeodomain factor deltaEF1.
10368288 1999 The solution structure of the guanine nucleotide exchange domain of human elongation factor 1beta reveals a striking resemblance to that of EF-Ts from Escherichia coli.
10094407 1999 A structural model for elongation factor 1 (EF-1) and phosphorylation by protein kinase CKII.
9677419 1998 Induction of acute translational response genes by homocysteine. Elongation factors-1alpha, -beta, and -delta.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.
9568107 Modulation of elongation factor-1 delta (EF-1 delta) expression by oncogenes in human epithelial cells.
9514931 1998 Interaction of the second coding exon of Tat with human EF-1 delta delineates a mechanism for HIV-1-mediated shut-off of host mRNA translation.
9407120 1997 Recombinant subunits of mammalian elongation factor 1 expressed in Escherichia coli. Subunit interactions, elongation activity, and phosphorylation by protein kinase CKII.
9353277 1997 Phosphorylation of elongation factor 1 and ribosomal protein S6 by multipotential S6 kinase and insulin stimulation of translational elongation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8743958 1996 Immunofluorescence studies of human fibroblasts demonstrate the presence of the complex of elongation factor-1 beta gamma delta in the endoplasmic reticulum.
8334168 1993 The human leucine zipper-containing guanine-nucleotide exchange protein elongation factor-1 delta.
8294461 1994 Reconstitution in vitro of the valyl-tRNA synthetase-elongation factor (EF) 1 beta gamma delta complex. Essential roles of the NH2-terminal extension of valyl-tRNA synthetase and of the EF-1 delta subunit in complex formation.
8168075 1994 Elongation factor 1 delta is enhanced following exposure to ionizing radiation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3169261 1988 Mammalian valyl-tRNA synthetase forms a complex with the first elongation factor.
2061327 1991 Phosphorylation of elongation factor 1 (EF-1) and valyl-tRNA synthetase by protein kinase C and stimulation of EF-1 activity.