Property Summary

NCBI Gene PubMed Count 52
PubMed Score 28.46
PubTator Score 35.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22721673 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21936567 our results demonstrate that EEF1D is a bona fide physiological CK2 substrate for CK2 phosphorylation
21633900 Taken together, our data suggest EFF1D functions as a novel negative regulator of SIAH-1
20514991 overexpression is positively correlated with malignant transformation of 16HBE cells induced by CdC12, but is not correlated with DNA mutations
19454010 Tandem affinity purification and mass spectrometry analysis identify eukaryotic translation elongation factor 1 delta (EEF1D), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17997862 Repression of deltaEF1 plays a key role in mediating BMP-6-induced transcriptional activation of E-cadherin in breast cancer cells.
More...

AA Sequence

MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGAS      1 - 70
SGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEP     71 - 140
PAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETD    141 - 210
MAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK    211 - 280
I//

Publication (72)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21994455 2011 Generation and comprehensive analysis of an influenza virus polymerase cellular interaction network.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21936567 2011 Unbiased functional proteomics strategy for protein kinase inhibitor validation and identification of bona fide protein kinase substrates: application to identification of EEF1D as a substrate for CK2.
More...