Property Summary

NCBI Gene PubMed Count 53
PubMed Score 29.45
PubTator Score 35.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.300 3.9e-26
ependymoma 1.200 1.2e-09
glioblastoma 1.100 1.6e-03
intraductal papillary-mucinous adenoma (... -1.300 1.8e-03
intraductal papillary-mucinous carcinoma... -1.700 2.1e-04
intraductal papillary-mucinous neoplasm ... -2.300 7.2e-04
lung cancer -3.800 4.1e-02
Multiple myeloma 1.313 5.6e-03
oligodendroglioma 1.300 3.6e-15
osteosarcoma -1.042 4.2e-05
sonic hedgehog group medulloblastoma 1.300 2.8e-05

Gene RIF (13)

AA Sequence

MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGAS      1 - 70
SGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEP     71 - 140
PAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETD    141 - 210
MAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK    211 - 280
I//

Text Mined References (73)

PMID Year Title