Property Summary

NCBI Gene PubMed Count 49
Grant Count 251
R01 Count 186
Funding $35,554,843.09
PubMed Score 867.76
PubTator Score 117.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.848 0.014
pancreatic cancer -2.000 0.008
psoriasis -2.400 0.000

Synonym

Accession P29622 Q53XB5 Q86TR9 Q96BZ5
Symbols KAL
KST
PI4
KLST
PI-4
kallistatin

Gene

 GO Process (1)

Gene RIF (19)

PMID Text
26790955 reveal novel mechanisms of kallistatin in inducing apoptosis and autophagy in breast cancer cells
26323298 crystal structure of kallistatin 1.9 A resolution
26156753 Kallistatin's heparin-binding site is crucial for preventing TGF-beta-induced miR-21 and oxidative stress, while its active site is key for stimulating the expression of eNOS.
26091968 Increased kallistatin levels in type 1 diabetes and its relation with carotid intima media thickness may reflect vascular dysfunction and suggest a link between micro- and macro-angiopathy.
25654330 Kallistatin protects against renal ischemia-reperfusion injury by blocking oxidative stress and renal inflammation.
25307947 decreased SPTBN1 and kallistatin gene expression associated with decreased relapse-free survival in hepatocellular carcinoma
24129914 these findings added the knowledge for us to understand the anti-angiogenic mechanism of kallistatin, which suggested that the rhKal could be worth as a candidate compound for further development for the purpose of anti-angiogenic therapies
23666756 A novel role of kallistatin in preventing breast tumor growth and mobility by direct interaction with LRP6.
23394256 Plasma kallistatin is a novel marker for severe community-acquired pneumonia prognosis.
23190873 As a potent antioxidant and anti-inflammation agent, kallistatin may also hold therapeutic promise in cardiometabolic disorders.
More...

AA Sequence

MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET      1 - 70
PGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVG     71 - 140
SALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLV    141 - 210
NYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL    211 - 280
PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG    281 - 350
ITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK    351 - 420
VVDPTKP                                                                   421 - 427
//

Text Mined References (50)

PMID Year Title
26790955 2016 Kallistatin induces breast cancer cell apoptosis and autophagy by modulating Wnt signaling and microRNA synthesis.
26323298 2015 Crystallization and crystallographic studies of kallistatin.
26156753 2015 Kallistatin inhibits TGF-?-induced endothelial-mesenchymal transition by differential regulation of microRNA-21 and eNOS expression.
26091968 2015 Kallistatin as a marker of microvascular complications in children and adolescents with type 1 diabetes mellitus: Relation to carotid intima media thickness.
25654330 2015 Effects of kallistatin on oxidative stress and inflammation on renal ischemia-reperfusion injury in mice.
25307947 2015 ?II-Spectrin (SPTBN1) suppresses progression of hepatocellular carcinoma and Wnt signaling by regulation of Wnt inhibitor kallistatin.
24172014 2013 Update of the human and mouse SERPIN gene superfamily.
24129914 2014 Recombinant human kallistatin inhibits angiogenesis by blocking VEGF signaling pathway.
23666756 2013 Kallistatin antagonizes Wnt/?-catenin signaling and cancer cell motility via binding to low-density lipoprotein receptor-related protein 6.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...