Property Summary

NCBI Gene PubMed Count 55
PubMed Score 905.27
PubTator Score 117.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 1.6e-11
pancreatic cancer 2398 7.7e-03
primary pancreatic ductal adenocarcinoma 1109 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 3.528 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic cancer -2.000 7.7e-03
primary pancreatic ductal adenocarcinoma -1.848 1.4e-02
psoriasis -2.400 1.6e-11

 GO Process (1)

Gene RIF (24)

AA Sequence

MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET      1 - 70
PGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVG     71 - 140
SALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLV    141 - 210
NYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL    211 - 280
PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSG    281 - 350
ITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK    351 - 420
VVDPTKP                                                                   421 - 427
//

Text Mined References (56)

PMID Year Title