Property Summary

NCBI Gene PubMed Count 130
Grant Count 120
R01 Count 84
Funding $9,306,458.95
PubMed Score 237.97
PubTator Score 197.81

Knowledge Summary

Patent (37,849)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.800 0.000
ependymoma 1.300 0.007
oligodendroglioma 1.100 0.009
osteosarcoma -1.584 0.000
glioblastoma 1.300 0.026
ovarian cancer 1.300 0.000

Synonym

Accession P29597 Q6QB10 Q96CH0
Symbols JTK1
IMD35

Gene

PDB

3LXN   3LXP   3NYX   3NZ0   3ZON   4GFO   4GIH   4GII   4GJ2   4GJ3   4GVJ   4OLI   4PO6   4PY1   4WOV   5C01   5C03   5F1Z   5F20  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (82)

PMID Text
26359499 The majority of disease-associated mutations in JAKs map to a pseudokinase domain (JH2), demonstrating its central regulatory function.
26294277 Genetic associations and gene-gene interactions of IRF5 and TYK2 were significantly detected in Han Chinese with systemic lupus erythematosus
26288847 The TYK2 promoter variant is associated with an overall risk for diabetes.
26239055 present findings suggest that TYK2 regulates apoptotic and proinflammatory pathways in pancreatic beta-cells via modulation of IFNalpha signaling, subsequent increase in MHC class I protein, and modulation of chemokines such as CXCL10.
25849893 the role of TYK2 in the pathogenesis of rheumatoid arthritis
25762719 Tyrosine Kinase 2-mediated Signal Transduction in T Lymphocytes Is Blocked by Pharmacological Stabilization of Its Pseudokinase Domain.
25744728 demonstration of the single marker association of tyrosine kinase-2 polymorphisms with ulcerative colitis and Crohn's disease in Turkish population.
25349176 Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders.
25156366 In cellular assays, SAR-20347 dose dependently (1 nM-10 muM) inhibited JAK1- and/or TYK2-dependent signaling from the IL-12/IL-23, IL-22, and IFN-alpha receptors.
24843152 Here, we report the 2.8-A structure of the two-domain pseudokinase-kinase module from the JAK family member TYK2 in its autoinhibited form.
More...

AA Sequence

MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPC      1 - 70
FNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQG     71 - 140
MQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTS    141 - 210
FKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHL    211 - 280
RLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQAS    281 - 350
LFGKKAKAHKAVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV    351 - 420
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQR    421 - 490
SQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSN    491 - 560
LIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTRTNVYEGRLRVEGSGDPEEGKMDDEDPLVPG    561 - 630
RDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLR    631 - 700
RERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSRE    701 - 770
ERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ    771 - 840
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGK    841 - 910
VSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEY    911 - 980
VPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPE    981 - 1050
GHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMT   1051 - 1120
VLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC      1121 - 1187
//

Text Mined References (135)

PMID Year Title
26359499 2015 Structural and Functional Characterization of the JH2 Pseudokinase Domain of JAK Family Tyrosine Kinase 2 (TYK2).
26294277 2015 Genetic association and interaction between the IRF5 and TYK2 genes and systemic lupus erythematosus in the Han Chinese population.
26288847 2015 TYK2 Promoter Variant and Diabetes Mellitus in the Japanese.
26239055 2015 TYK2, a Candidate Gene for Type 1 Diabetes, Modulates Apoptosis and the Innate Immune Response in Human Pancreatic ?-Cells.
25849893 2015 TYK2 protein-coding variants protect against rheumatoid arthritis and autoimmunity, with no evidence of major pleiotropic effects on non-autoimmune complex traits.
25762719 2015 Tyrosine Kinase 2-mediated Signal Transduction in T Lymphocytes Is Blocked by Pharmacological Stabilization of Its Pseudokinase Domain.
25744728 2015 Tyrosine kinase-2 gene polymorphisms are associated with ulcerative colitis and Crohn's disease in Turkish Population.
25416956 2014 A proteome-scale map of the human interactome network.
25349176 2014 A novel recurrent NPM1-TYK2 gene fusion in cutaneous CD30-positive lymphoproliferative disorders.
25156366 2014 Inhibition of TYK2 and JAK1 ameliorates imiquimod-induced psoriasis-like dermatitis by inhibiting IL-22 and the IL-23/IL-17 axis.
More...