Property Summary

Ligand Count 134
NCBI Gene PubMed Count 140
PubMed Score 252.91
PubTator Score 197.81

Knowledge Summary

Patent (37,849)

TINX Plot

  Disease (8)

Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
ovarian cancer 8520 1.2e-05
osteosarcoma 7950 1.1e-04
ependymoma 4679 6.7e-03
oligodendroglioma 2850 8.9e-03
astrocytic glioma 2597 1.2e-02
glioblastoma 5792 2.6e-02
Disease Target Count Z-score Confidence
psoriasis 6694 3.39 1.7
Crohn's disease 321 0.0 3.0
Type 1 diabetes mellitus 109 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 1.2e-02
ependymoma 1.300 6.7e-03
glioblastoma 1.300 2.6e-02
oligodendroglioma 1.100 8.9e-03
osteosarcoma -1.584 1.1e-04
ovarian cancer 1.300 1.2e-05

 OMIM Phenotype (1)

Protein-protein Interaction (6)

PDB (21)

Gene RIF (91)

AA Sequence

MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPC      1 - 70
FNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQG     71 - 140
MQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTS    141 - 210
FKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHL    211 - 280
RLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQAS    281 - 350
LFGKKAKAHKAVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV    351 - 420
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQR    421 - 490
SQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSN    491 - 560
LIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTRTNVYEGRLRVEGSGDPEEGKMDDEDPLVPG    561 - 630
RDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLR    631 - 700
RERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSRE    701 - 770
ERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ    771 - 840
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKIRDLGEGHFGK    841 - 910
VSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEY    911 - 980
VPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPE    981 - 1050
GHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMT   1051 - 1120
VLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC      1121 - 1187
//

Text Mined References (145)

PMID Year Title