Property Summary

NCBI Gene PubMed Count 394
Grant Count 208
R01 Count 145
Funding $20,346,681.42
PubMed Score 345.22
PubTator Score 1267.17

Knowledge Summary

Patent

No data available

Expression

Gene

PML

PDB

1BOR   2MVW   2MWX   4WJN   4WJO  

Gene RIF (299)

PMID Text
27052408 Data suggest that hematopoietically expressed homeobox protein (HHEX) downmodulation by promyelocytic leukemia-retinoic acid receptor alpha fusion oncoprotein (PML-RARalpha) is a key event during acute promyelocytic leukemia (APL) pathogenesis.
27030546 Suggest a novel role of PCGF2 in arsenic trioxide-mediated degradation of PML-RARA that PCGF2 might act as a negative regulator of UBE2I via direct interaction.
27000403 The authors show that PML can inhibit HIV-1 and other lentiviruses as part of the IFN-I-mediated response.
26728854 The results corroborated that PML-II plays a critical role in generating nuclear Lipid droplets in specific cell types.
26728337 Mutations affect both the rearranged and the unrearranged PML alleles in refractory acute promyelocytic leukaemia.
26703718 PML contributes to the intrinsic restriction of HIV-1 infections in a cell type-dependent manner.
26703467 Authors demonstrate leukemogenicity of PAX5-PML by introducing it into normal mouse pro-B cells; B-cell linker protein (Blnk) is repressed by PAX5-PML in leukemia cells; enforced expression of Blnk increases survival despite introduction of PAX5-PML.
26675234 The association of RNF168 with PML NBs resulted in increased ubiquitylation.
26578773 PML IV enhances global SUMO-1 conjugation, particularly that of p53, resulting in p53 stabilization and activation.
26566030 identifying Daxx as a broad cellular inhibitor of reverse-transcription. Altogether, these findings unravel a novel antiviral function for PML and PML nuclear body-associated protein Daxx
More...

AA Sequence

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL      1 - 70
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC     71 - 140
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP    141 - 210
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR    211 - 280
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG    281 - 350
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE    351 - 420
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK    421 - 490
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVIS    491 - 560
SSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAV    561 - 630
NRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEF    631 - 700
QEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVY    701 - 770
PFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA    771 - 840
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS                                841 - 882
//

Text Mined References (418)

PMID Year Title
27052408 2016 PML-RAR alpha induces the downmodulation of HHEX: a key event responsible for the induction of an angiogenetic response.
27030546 2016 PCGF2 negatively regulates arsenic trioxide-induced PML-RARA protein degradation via UBE2I inhibition in NB4 cells.
27000403 2016 The interferon-induced antiviral protein PML (TRIM19) promotes the restriction and transcriptional silencing of lentiviruses in a context-specific, isoform-specific fashion.
26728854 2016 PML isoform II plays a critical role in nuclear lipid droplet formation.
26728337 2016 Mutations affecting both the rearranged and the unrearranged PML alleles in refractory acute promyelocytic leukaemia.
26703718 2015 TRIM19/PML Restricts HIV Infection in a Cell Type-Dependent Manner.
26703467 2016 B Cell Linker Protein (BLNK) Is a Selective Target of Repression by PAX5-PML Protein in the Differentiation Block That Leads to the Development of Acute Lymphoblastic Leukemia.
26675234 2016 Identification of RNF168 as a PML nuclear body regulator.
26578773 2015 PML IV/ARF interaction enhances p53 SUMO-1 conjugation, activation, and senescence.
26566030 2015 PML/TRIM19-Dependent Inhibition of Retroviral Reverse-Transcription by Daxx.
More...