Property Summary

NCBI Gene PubMed Count 417
PubMed Score 373.76
PubTator Score 1267.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.200 9.2e-04
atypical teratoid / rhabdoid tumor 1.700 5.2e-08
cutaneous lupus erythematosus 1.200 1.0e-03
head and neck cancer 1.100 1.3e-04
intraductal papillary-mucinous adenoma (... 1.200 1.0e-02
intraductal papillary-mucinous neoplasm ... 1.400 2.0e-03
medulloblastoma 1.300 9.8e-06
medulloblastoma, large-cell 1.600 2.1e-04
Multiple Sclerosis 1.600 2.1e-02
osteosarcoma -1.385 1.1e-05
ovarian cancer 1.500 3.2e-12
pediatric high grade glioma 1.300 3.1e-04
ulcerative colitis 1.100 1.1e-05

Protein-protein Interaction (7)

Gene RIF (320)

AA Sequence

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLL      1 - 70
PCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWC     71 - 140
FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKP    141 - 210
LCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIR    211 - 280
ERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHG    281 - 350
FLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE    351 - 420
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIK    421 - 490
MESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVIS    491 - 560
SSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAV    561 - 630
NRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEF    631 - 700
QEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVY    701 - 770
PFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA    771 - 840
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS                                841 - 882
//

Text Mined References (442)

PMID Year Title