Property Summary

NCBI Gene PubMed Count 21
PubMed Score 303.16
PubTator Score 149.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 4.20840108709211E-30
glioblastoma multiforme 347 1.87892429878335E-15
juvenile dermatomyositis 1189 8.0331977658051E-12
Breast cancer 3099 1.8506587081665E-9
pilocytic astrocytoma 3086 1.02891090275015E-6
ulcerative colitis 2087 3.7341456920361E-6
primary pancreatic ductal adenocarcinoma 1271 7.64202524087452E-6
acute quadriplegic myopathy 1157 7.673967971841E-5
Pick disease 1893 8.78424126035707E-5
pancreatic cancer 2300 1.80352102898615E-4
invasive ductal carcinoma 2950 0.00149356963998867
atypical teratoid / rhabdoid tumor 4369 0.00246817303249323
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00390461776356757
gastric carcinoma 832 0.00678759564624036
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0206160596563235
subependymal giant cell astrocytoma 2287 0.0246140783588403
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.112 1.6
Vascular disease 281 3.08 1.5

Expression

Synonym

Accession P29558 Q14869 Q15433 Q53P46 Q53QX8 Q53RG6 Q8WV20
Symbols YC1
MSSP
SCR2
HCC-4
MSSP-1
MSSP-2
MSSP-3
C2orf12

Gene

PDB

1X5O  

  Ortholog (13)

 GWAS Trait (1)

Pathway (1)

Gene RIF (3)

PMID Text
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20418489 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP      1 - 70
PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP     71 - 140
TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP    141 - 210
GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATN    211 - 280
RMITQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLG    281 - 350
STGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK                  351 - 406
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20418489 2010 Genetic variants at 2q24 are associated with susceptibility to type 2 diabetes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...