Property Summary

NCBI Gene PubMed Count 21
PubMed Score 309.46
PubTator Score 149.92

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29558 Q14869 Q15433 Q53P46 Q53QX8 Q53RG6 Q8WV20
Symbols YC1
MSSP
SCR2
HCC-4
MSSP-1
MSSP-2
MSSP-3
C2orf12

Gene

PDB

1X5O  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLP      1 - 70
PHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKASGVQAQMAKQQEQDP     71 - 140
TNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPP    141 - 210
GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEVRLAGMTLTYDPTTAAIQNGFYPSPYSIATN    211 - 280
RMITQTSITPYIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLG    281 - 350
STGTYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK                  351 - 406
//

Text Mined References (24)

PMID Year Title