Property Summary

NCBI Gene PubMed Count 19
PubMed Score 111.98
PubTator Score 551.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Endometriosis 535
Disease Target Count P-value
breast carcinoma 1614 1.20355619489211E-32
non-small cell lung cancer 2798 2.1034797592165E-16
adrenocortical carcinoma 1427 1.34178237376096E-7
lung adenocarcinoma 2714 4.05090787205849E-7
cystic fibrosis 1670 2.2181429030615E-6
colon cancer 1475 4.95862194770678E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.41300903127688E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.53440433789481E-5
invasive ductal carcinoma 2950 1.0470120298677E-4
ductal carcinoma in situ 1745 1.18257334682504E-4
psoriasis 6685 5.34853347720361E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.9788642140165E-4
pilocytic astrocytoma 3086 9.84968371833112E-4
acute quadriplegic myopathy 1157 0.00294684027800453
fibroadenoma 557 0.0180905076824912
subependymal giant cell astrocytoma 2287 0.0329875824444361
Pick disease 1893 0.0477343671485162
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Disease Target Count Z-score Confidence
steroid-induced glaucoma 6 3.078 1.5

Expression

Synonym

Accession P29536 B1APV6 C4AMB1 Q68EN2
Symbols 1D
D1
64kD
SMLMOD
SM-LMOD

Gene

PDB

4Z8G   4Z94   4Z79  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (11)

PMID Text
22157009 Lmod1 is a new SMC-restricted SRF/MYOCD target gene.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
16633140 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11350761 Lmod1 is a component of the smooth muscle contractile apparatus extractable by high salt, not a transmembrane protein as previously predicted.
11318603 Lmod1 is a member of the Tropomodulin family of actin binding proteins, and is most highly expressed in smooth muscle.
More...

AA Sequence

MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN      1 - 70
FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE     71 - 140
AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE    141 - 210
MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK    211 - 280
EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR    281 - 350
FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL    351 - 420
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG    421 - 490
EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR    491 - 560
KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ                                  561 - 600
//

Text Mined References (22)

PMID Year Title
27144530 2016 MEF2C-MYOCD and Leiomodin1 Suppression by miRNA-214 Promotes Smooth Muscle Cell Phenotype Switching in Pulmonary Arterial Hypertension.
26370058 2015 How Leiomodin and Tropomodulin use a common fold for different actin assembly functions.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22157009 2012 Leiomodin 1, a new serum response factor-dependent target gene expressed preferentially in differentiated smooth muscle cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
More...