Property Summary

NCBI Gene PubMed Count 21
PubMed Score 114.13
PubTator Score 551.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Breast cancer -2.700 2.0e-50
acute quadriplegic myopathy -1.183 2.9e-03
adrenocortical carcinoma -2.924 1.3e-07
Astrocytoma, Pilocytic 1.200 2.2e-03
breast carcinoma -1.700 5.3e-07
colon cancer -2.700 5.0e-06
cystic fibrosis -1.998 2.2e-06
ductal carcinoma in situ -1.900 1.2e-04
fibroadenoma -1.100 1.8e-02
intraductal papillary-mucinous adenoma (... -1.400 1.4e-05
intraductal papillary-mucinous carcinoma... -1.500 2.5e-05
intraductal papillary-mucinous neoplasm ... -1.500 6.0e-04
invasive ductal carcinoma -2.800 1.0e-04
lung adenocarcinoma -1.201 4.1e-07
non-small cell lung cancer -1.719 2.1e-16
Pick disease 1.100 4.8e-02
psoriasis -1.700 3.1e-06
subependymal giant cell astrocytoma 1.410 3.3e-02

Gene RIF (13)

AA Sequence

MSRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLN      1 - 70
FCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDE     71 - 140
AGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREE    141 - 210
MKEVAKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKNEPLHEK    211 - 280
EAKDDSKTKTPEKQTPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVR    281 - 350
FTEALEFNTVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL    351 - 420
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKRLQEQRQAQEAKG    421 - 490
EKKDLLEVPKAGAVAKGSPKPSPQPSPKPSPKNSPKKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQR    491 - 560
KMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ                                  561 - 600
//

Text Mined References (23)

PMID Year Title