Property Summary

NCBI Gene PubMed Count 95
PubMed Score 504.35
PubTator Score 1826.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis 2.500 8.5e-03
cutaneous lupus erythematosus 3.700 1.1e-04
esophageal adenocarcinoma -3.900 2.9e-02
interstitial cystitis 3.300 2.2e-02
lung carcinoma -1.400 5.0e-02
nasopharyngeal carcinoma -2.700 6.1e-04
non-small cell lung cancer 3.649 2.2e-11
pancreatic cancer 1.600 5.7e-03
psoriasis 5.500 8.6e-12
ulcerative colitis 3.700 9.0e-04

Gene RIF (75)

AA Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKA      1 - 70
ATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAP     71 - 140
EESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSI    141 - 210
QMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV    211 - 280
DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVV    281 - 350
GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP                                  351 - 390
//

Text Mined References (99)

PMID Year Title