Property Summary

NCBI Gene PubMed Count 89
PubMed Score 459.56
PubTator Score 1826.61

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -3.900 0.029
psoriasis 6.600 0.000
cutaneous lupus erythematosus 3.700 0.000
Atopic dermatitis 2.500 0.008
non-small cell lung cancer 3.649 0.000
pancreatic cancer 1.600 0.006
interstitial cystitis 3.700 0.009
nasopharyngeal carcinoma -2.700 0.001
lung carcinoma -1.400 0.050
ulcerative colitis 3.700 0.001


Accession P29508 A6NDM2 B2RBT5 B3W5Y6 Q53H28 Q53YB5 Q86VF3 Q86W04 Q8IWL4 Q8IXI3 Q96J21 Q9BYF8
Symbols SCC



2ZV6   4ZK0   4ZK3  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG
Opossum OMA EggNOG

Gene RIF (69)

26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26634820 SerpinB3 indirectly increased the transcription of Myc through the induction of Yap pathway.
26408719 High SCC serum levels are associated with Head and Neck Cancer.
25840050 The diagnostic performance of SCCA-IgM immune complexes for hepatocellular carcinoma was found to be frequently superior to that of alpha-fetoprotein. (Review)
25622661 serum level significant risk factor for overall survival in cancers of the oral cavity, hypopharynx, and larynx
25544768 Data indicate that hypoxia-induced cysteine-proteases inhibitor SERPINB3 up-regulation is dependent on hypoxia-inducible factor-2alpha (HIF-2alpha).
25129443 Serum SCCA levels were significantly elevated in hepatocellular carcinoma.
25111616 Silencing of SERPINB3/B4 in human keratinocytes decreased S100A8 expression, supporting a role for SERPINB3/B4 in the initiation of the acute inflammatory response.
24962668 High serpinB3 protein content was found to be a biomarker of successful healing in diabetic patients.
24905620 High serum SCCA levels are associated with squamous cell cervical cancer.

AA Sequence

GFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP                                  351 - 390

Text Mined References (93)

PMID Year Title
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26634820 2015 SerpinB3 and Yap Interplay Increases Myc Oncogenic Activity.
26408719 2015 The Diagnostic and Prognostic Value of Tumor Markers (CEA, SCC, CYFRA 21-1, TPS) in Head and Neck Cancer Patients.
25840050 2015 Squamous cell carcinoma antigen in hepatocellular carcinoma: Ready for the prime time?
25622661 2015 Prognostic significance of serum squamous cell carcinoma antigen in patients with head and neck cancer.
25544768 2015 Hypoxia up-regulates SERPINB3 through HIF-2? in human liver cancer cells.
25129443 2014 Evaluation of squamous cell carcinoma antigen-immunoglobulin M complex (SCCA-IGM) and alpha-L-fucosidase (AFU) as novel diagnostic biomarkers for hepatocellular carcinoma.
25111616 2015 SERPINB3/B4 contributes to early inflammation and barrier dysfunction in an experimental murine model of atopic dermatitis.
24962668 2014 The molecular signature of impaired diabetic wound healing identifies serpinB3 as a healing biomarker.
24905620 2014 Twelve serum proteins progressively increase with disease stage in squamous cell cervical cancer patients.