Property Summary

NCBI Gene PubMed Count 309
Grant Count 956
R01 Count 614
Funding $95,693,600.74
PubMed Score 1820.85
PubTator Score 1313.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (56)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.600 0.001
ependymoma -1.700 0.001
oligodendroglioma -1.600 0.001
osteosarcoma 1.471 0.048
glioblastoma -1.200 0.002
group 3 medulloblastoma -2.800 0.000
periodontitis -1.200 0.000
medulloblastoma, large-cell -1.100 0.001
primitive neuroectodermal tumor -1.800 0.002
Duchenne muscular dystrophy -1.106 0.000
acute quadriplegic myopathy -1.064 0.001
pediatric high grade glioma -1.200 0.000
atypical teratoid/rhabdoid tumor -1.100 0.000
psoriasis 1.300 0.000
lung carcinoma 1.400 0.001
ovarian cancer -1.800 0.000
pituitary cancer -1.700 0.005

Synonym

Accession P29475 E9PH30 O75713
Symbols NOS
bNOS
nNOS
IHPS1
N-NOS
NC-NOS

Gene

PDB

4D1N   4UCH   4UH5   4UH6   4V3U   5ADF   5ADG   5ADI   5FVU   5FVV   5FVW   5FVX  

Gene RIF (294)

PMID Text
26923072 DLC1 binding to nNOS-calmodulin complex does not affect the electron transport from the reductase to the oxygenase domain.
26791826 We conclude that DNM2 is a novel negative regulator of NO production in mouse collecting ducts.
26458913 CoCl2 increased nNOS expression and NO production in human neuroblastoma SK-N-SH cells by increasing HIF-1a expression and binding to a a hypoxia response element in the nNos promoter.
26378238 analysis of the interaction between nNOS and dystrophin repeats 16 and 17
25902315 This study first-time showed highest Red Blood Cell (RBC)-Nitric Oxide Synthase activation and nitric oxide production in old RBC.
25871004 polymorphisms in the gene may be useful in identifying women at risk for osteoporosis.
25855559 Single nucleotide polymorphisms in nNOS, renalase, MTHFR, CELSR1 and XYLB genes were found significantly associated with ischemic stroke in Chinese patients.
25724429 Tetrahydrobiopterin:dihydrobiopterin ratio is lower in tumor tissues and, as a consequence, NOS activity generates more peroxynitrite and superoxide anion than nitric oxide, resulting in important tumor growth-promoting and antiapoptotic signaling properties.
25613138 The gene expression of NOS1 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25490993 Results suggested a link between NOS1 gene polymorphism at rs3782206 and cognitive functions and their neural underpinnings at the right inferior frontal gyrus
More...

AA Sequence

MEDHMFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNGR      1 - 70
PLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPP     71 - 140
AGKEQPLAVDGASGPGNGPQHAYDDGQEAGSLPHANGLAPRPPGQDPAKKATRVSLQGRGENNELLKEIE    141 - 210
PVLSLLTSGSRGVKGGAPAKAEMKDMGIQVDRDLDGKSHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYS    211 - 280
EKEQPPTSGKQSPTKNGSPSKCPRFLKVKNWETEVVLTDTLHLKSTLETGCTEYICMGSIMHPSQHARRP    281 - 350
EDVRTKGQLFPLAKEFIDQYYSSIKRFGSKAHMERLEEVNKEIDTTSTYQLKDTELIYGAKHAWRNASRC    351 - 420
VGRIQWSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLIRYAGY    421 - 490
KQPDGSTLGDPANVQFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHPKFEWFK    491 - 560
DLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMNLDMRKTSSLW    561 - 630
KDQALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEM    631 - 700
LNYRLTPSFEYQPDPWNTHVWKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGK    701 - 770
SQAYAKTLCEIFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQ    771 - 840
EERKSYKVRFNSVSSYSDSQKSSGDGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAFGHAVDTLLEE    841 - 910
LGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISNDRSWKRNKFRLTFVA    911 - 980
EAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTNGSQELQYQPGDHLGVFPGNHEDLVN    981 - 1050
ALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASL   1051 - 1120
ATSEKEKQRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYP   1121 - 1190
DEVHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAP   1191 - 1260
FRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDKPKKYVQD   1261 - 1330
ILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIF   1331 - 1400
GVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS                                       1401 - 1434
//

Text Mined References (310)

PMID Year Title
26923072 2016 The protein inhibitor of nNOS (PIN/DLC1/LC8) binding does not inhibit the NADPH-dependent heme reduction in nNOS, a key step in NO synthesis.
26791826 2016 Dynamin-2 is a novel NOS1? interacting protein and negative regulator in the collecting duct.
26458913 2015 Up-Regulation of Neuronal Nitric Oxide Synthase Expression by Cobalt Chloride Through a HIF-1? Mechanism in Neuroblastoma Cells.
26378238 2015 Structural Basis of Neuronal Nitric-oxide Synthase Interaction with Dystrophin Repeats 16 and 17.
25902315 2015 Increase in Red Blood Cell-Nitric Oxide Synthase Dependent Nitric Oxide Production during Red Blood Cell Aging in Health and Disease: A Study on Age Dependent Changes of Rheologic and Enzymatic Properties in Red Blood Cells.
25871004 2015 Polymorphisms in neuropeptide genes and bone mineral density in Korean postmenopausal women.
25855559 2015 Pooled genetic analysis reveals an association of SNPs of only a few genes with risk predisposition to ischemic stroke in a Chinese population.
25724429 2015 The Role of Nitric Oxide Synthase Uncoupling in Tumor Progression.
25490993 2015 Evidence for the contribution of NOS1 gene polymorphism (rs3782206) to prefrontal function in schizophrenia patients and healthy controls.
25460324 2015 Neuronal NOS localises to human airway cilia.
More...