Property Summary

NCBI Gene PubMed Count 226
Grant Count 702
R01 Count 393
Funding $63,328,851.95
PubMed Score 1655.15
PubTator Score 917.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Expression

  Differential Expression (24)

Disease log2 FC p
nephrosclerosis 1.318 0.000
Chronic Lymphocytic Leukemia -1.038 0.021
Multiple myeloma 1.388 0.037
malignant mesothelioma -4.400 0.000
cutaneous lupus erythematosus 1.800 0.000
psoriasis 2.100 0.000
glioblastoma 2.800 0.000
cystic fibrosis 1.383 0.001
medulloblastoma, large-cell -1.300 0.003
juvenile dermatomyositis 1.276 0.000
chronic kidney disease 1.200 0.049
non-small cell lung cancer -1.228 0.000
colon cancer -1.500 0.026
lung cancer -3.900 0.000
active Crohn's disease 2.552 0.001
ulcerative colitis 2.300 0.000
Breast cancer 3.800 0.026
adult high grade glioma 1.700 0.000
pilocytic astrocytoma 1.900 0.000
primary Sjogren syndrome 1.400 0.000
subependymal giant cell astrocytoma 2.500 0.036
lung adenocarcinoma -1.060 0.010
lung carcinoma -2.800 0.000
ovarian cancer -2.900 0.000

Synonym

Accession P29466 B5MDZ1 Q53EY6 Q6DMQ1 Q6GSS3 Q6PI75 Q9UCN3 CASP-1
Symbols ICE
P45
IL1BC

Gene

PDB

1BMQ   1IBC   1ICE   1RWK   1RWM   1RWN   1RWO   1RWP   1RWV   1RWW   1RWX   1SC1   1SC3   1SC4   2FQQ   2H48   2H4W   2H4Y   2H51   2H54   2HBQ   2HBR   2HBY   2HBZ   3D6F   3D6H   3D6M   3E4C   3NS7   5FNA  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
896 confirmatory 13 / 10 / 35 Confirmation Concentration-Response Assay for Allosteric/Competitive Inhibitors of Caspase-1
900 confirmatory 21 / 3015 / 71992 qHTS Assay for Allosteric/Competitive Inhibitors of Caspase-1
2389 summary 6 / 0 / 0 qHTS Assay for Allosteric/Competitive Inhibitors of Caspase-1: Summary
2494 confirmatory 9 / 0 / 1 Confirmation Assay for Allosteric/Competitive Inhibitors of Caspase-1
488857 screening 563 / 0 / 812 Single concentration confirmation of inhibitors of NALP1 in yeast using a Caspase-1-ASC counter screen.
488863 confirmatory 30 / 0 / 11 Dose Response confirmation of inhibitors of NALP1 in yeast using a Caspase-1-ASC counter screen.

Gene RIF (161)

PMID Text
26599267 These results suggest that released caspase-1 exists in a unique complex that is functionally stable and protected from immunodepletion whereas cell-extract generated active caspase-1 is rapidly inhibited in the cytosolic milieu.
26510601 Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever.
26496436 Genetic polymorphisms in Nalp3 and caspase-1 may be associated with individual susceptibility to silicosis, especially when the polymorphisms interact with age, cumulative dust exposure, or smoking status.
26466953 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26457439 The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media.
26453510 The results indicate that acteoside may act as a regulator of the IL-32 induced immune responses.
26324711 Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2
26324708 production of 20-kDa IL-1beta may act to limitIL-1beta signaling by reducing the pool of pro-IL-1beta availability for caspase-1 cleavage
26240347 the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activation
26218605 specific caspase cleavage sites in Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasome
More...

AA Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ      1 - 70
ICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEE     71 - 140
AQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASD    141 - 210
MTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVI    211 - 280
IIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI    281 - 350
GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH                    351 - 404
//

Text Mined References (229)

PMID Year Title
26599267 2015 Monocyte Caspase-1 Is Released in a Stable, Active High Molecular Weight Complex Distinct from the Unstable Cell Lysate-Activated Caspase-1.
26510601 [Influence of M680I and M694V mutations on pyrin's domain B30.2 tertiary structure and it's complex formation ability with caspase-1].
26496436 2015 Effects of the Interactions between Dust Exposure and Genetic Polymorphisms in Nalp3, Caspase-1, and IL-1? on the Risk of Silicosis: A Case-Control Study.
26466953 2015 Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.
26457439 2016 Activation of NLRP3 inflammasome in human middle ear cholesteatoma and chronic otitis media.
26453510 2015 Attenuation of IL-32-induced caspase-1 and nuclear factor-?B activations by acteoside.
26324711 2015 Interleukin-1? Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2: IMPLICATIONS FOR ALLOGRAFT REJECTION.
26324708 2015 Acid-dependent Interleukin-1 (IL-1) Cleavage Limits Available Pro-IL-1? for Caspase-1 Cleavage.
26240347 2015 MTMR3 risk allele enhances innate receptor-induced signaling and cytokines by decreasing autophagy and increasing caspase-1 activation.
26218605 2015 Identification of Caspase Cleavage Sites in KSHV Latency-Associated Nuclear Antigen and Their Effects on Caspase-Related Host Defense Responses.
More...