Property Summary

Ligand Count 372
NCBI Gene PubMed Count 249
PubMed Score 1808.04
PubTator Score 917.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.716 2.7e-03
active ulcerative colitis 1.141 8.8e-03
adult high grade glioma 1.700 4.7e-04
Astrocytoma, Pilocytic 1.500 4.6e-06
Breast cancer 3.800 2.6e-02
chronic kidney disease 1.200 4.9e-02
Chronic Lymphocytic Leukemia -1.038 2.1e-02
colon cancer -1.500 2.6e-02
cutaneous lupus erythematosus 1.500 1.9e-03
cystic fibrosis 1.168 2.7e-04
glioblastoma 1.300 2.0e-03
juvenile dermatomyositis 1.002 1.7e-09
lung adenocarcinoma -1.060 1.0e-02
lung cancer -2.300 4.4e-04
lung carcinoma -2.800 6.6e-27
malignant mesothelioma -4.100 4.2e-07
medulloblastoma, large-cell -1.300 3.4e-03
Multiple myeloma 1.322 2.5e-02
nephrosclerosis 1.318 2.4e-04
non-small cell lung cancer -1.228 1.1e-11
ovarian cancer -2.400 1.3e-09
primary Sjogren syndrome 1.300 4.4e-04
psoriasis 2.100 1.3e-04
subependymal giant cell astrocytoma 1.808 3.4e-02

Protein-protein Interaction (7)

Gene RIF (181)

AA Sequence

MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ      1 - 70
ICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEE     71 - 140
AQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASD    141 - 210
MTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVI    211 - 280
IIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFI    281 - 350
GRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH                    351 - 404
//

Text Mined References (254)

PMID Year Title