Property Summary

NCBI Gene PubMed Count 445
PubMed Score 19.20
PubTator Score 391.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 4.900 0.000

Synonym

Accession P29460 IL-12B
Symbols CLMF
NKSF
CLMF2
IMD28
IMD29
NKSF2
IL-12B

Gene

PDB

3D85   3D87   3DUH   3QWR   4GRW   4OE8   4OG9   1F42   1F45   3HMX  

 GWAS Trait (1)

Gene RIF (466)

PMID Text
26874795 High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells
26697414 These observations indicate a HDAC1-mediated IL-12B gene expression suppression by live, virulent Mycobacterium tuberculosis to subvert the immune system to survive and replicate in the host.
26667837 IL12Brs3212227 and IFNgammars2069705 variants were associated with a decreased risk of invasive aspergillosis.
26667304 a tendency of a higher prevalence of the genotype IL-12p40 pro1.1 in systemic arthritis and in rheumatoid factor negative polyarthritis was observed but not significant
26663019 genetic polymorphism is associated with allergic rhinitis in Chinese patients
26516307 variant IL-12p40 1188C/A genotype was AA (72.92%), AC (23.96%), and CC (3.13%%) in patients as compared to 65%, 30%, and 5%, respectively, in controls.
26472011 genetic polymorphism is associated with psoriasis in the South Indian Tamils
26430781 IL-12 immunomodulation delays the onset of lethal peritoneal disease of ovarian cancer.
26375522 the IL-12B rs3212227 AC and AC+CC genotypes are associated with rheumatoid arthritis risk in older patients,rheumatoid factor positive patients and anti-cyclic peptide antibodies negative patients
26302971 No association was observed for IL-12B and IFN-gamma polymorphisms between the rheumatoid arthritis patients and controls.
More...

AA Sequence

MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLG      1 - 70
SGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRF     71 - 140
TCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEV    141 - 210
MVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGK    211 - 280
SKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS                          281 - 328
//

Text Mined References (447)

PMID Year Title
26874795 2016 The relationships between serum cytokine levels and tumor infiltrating immune cells and their clinical significance in colorectal cancer.
26697414 2015 Mycobacterium tuberculosis Infection Induces HDAC1-Mediated Suppression of IL-12B Gene Expression in Macrophages.
26667837 2015 Polymorphisms in Host Immunity-Modulating Genes and Risk of Invasive Aspergillosis: Results from the AspBIOmics Consortium.
26667304 2015 No association of IL-12p40 pro1.1 polymorphism with juvenile idiopathic arthritis.
26663019 2016 Genetic variations in interleukin-12B in allergic rhinitis.
26516307 2015 Single Nucleotide Polymorphisms in IL-10, IL-12p40, and IL-13 Genes and Susceptibility to Glioma.
26472011 2016 Investigation of association of the IL-12B and IL-23R genetic variations with psoriatic risk in a South Indian Tamil cohort.
26430781 2016 Interleukin-12 Immunomodulation Delays the Onset of Lethal Peritoneal Disease of Ovarian Cancer.
26375522 2015 Association between polymorphisms of interleukin 12 and rheumatoid arthritis associated biomarkers in a Chinese population.
26302971 2015 Interleukin-18, interleukin-12B and interferon-? gene polymorphisms in Brazilian patients with rheumatoid arthritis: a pilot study.
More...