Property Summary

NCBI Gene PubMed Count 303
PubMed Score 8.16
PubTator Score 357.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29459 Q96QZ1 IL-12A
Symbols P35
CLMF
NFSK
NKSF1
IL-12A

Gene

PDB

1F45   3HMX  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid

 IMPC Term (1)

 GWAS Trait (1)

Gene RIF (309)

PMID Text
26966064 These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1.
26960148 p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells.
26514528 Low IL12 expression levels are associated with Acute Leukemia.
26431888 IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML.
26375522 the functional single nucleotide polymorphism IL-12A rs2243115 GG genotype may increase the risk of rheumatoid arthritis in rheumatoid factor negative patients
26370008 IL-35 plays a protective role in the pathogenesis of rheumatoid arthritis
26225474 IL-35 Is Involved in the Pathogenesis of Guillain-Barre Syndrome Through Its Influence on the Function of CD4+ T Cells
26204444 Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA.
26104769 Gene-gene interaction analysis showed that subjects carrying the IL-12A rs568408AG/AA and IL-12B rs3212227AA genotypes had a 2.40-fold increased risk of CRC (OR = 2.40; 95 % CI, 1.14-5.07)
26085094 Insight into the control of vascular inflammation by IL-35.
More...

AA Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEID      1 - 70
HEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKT     71 - 140
MNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTID    141 - 210
RVMSYLNAS                                                                 211 - 219
//

Text Mined References (305)

PMID Year Title
26966064 2016 Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells.
26960148 2016 Exogenous Thyropin from p41 Invariant Chain Diminishes Cysteine Protease Activity and Affects IL-12 Secretion during Maturation of Human Dendritic Cells.
26514528 2015 Assessment of Relationship between Wilms' Tumor Gene (WT1) Expression in Peripheral Blood of Acute Leukemia Patients and Serum IL-12 and C3 Levels.
26431888 2015 Elevated IL-35 in bone marrow of the patients with acute myeloid leukemia.
26375522 2015 Association between polymorphisms of interleukin 12 and rheumatoid arthritis associated biomarkers in a Chinese population.
26370008 2015 Low Serum Levels of Interleukin 35 in Patients with Rheumatoid Arthritis.
26225474 2015 IL-35 Is Involved in the Pathogenesis of Guillain-Barré Syndrome Through Its Influence on the Function of CD4+ T Cells.
26204444 2015 Interleukin 35 Synovial Fluid Levels Are Associated with Disease Activity of Rheumatoid Arthritis.
26104769 2015 Interaction analysis of IL-12A and IL-12B polymorphisms with the risk of colorectal cancer.
26085094 2015 Interleukin-35 Inhibits Endothelial Cell Activation by Suppressing MAPK-AP-1 Pathway.
More...