Property Summary

NCBI Gene PubMed Count 303
Grant Count 3
Funding $121,077
PubMed Score 8.16
PubTator Score 357.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29459 Q96QZ1 IL-12A
Symbols P35
CLMF
NFSK
NKSF1
IL-12A

Gene

PDB

1F45   3HMX  

 IMPC Term (1)

 GWAS Trait (1)

Gene RIF (312)

PMID Text
26966064 These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1.
26960148 p41 fragment is also shown to reduce the secretion of interleukin-12 (IL-12/p70) during the subsequent maturation of treated dendritic cells.
26514528 Low IL12 expression levels are associated with Acute Leukemia.
26431888 IL-35 was elevated in bone marrow of adult AML patients and this increase was correlated with the clinical stages of malignancy, suggesting that IL-35 is involved in pathogenesis of AML.
26375522 the functional single nucleotide polymorphism IL-12A rs2243115 GG genotype may increase the risk of rheumatoid arthritis in rheumatoid factor negative patients
26370008 IL-35 plays a protective role in the pathogenesis of rheumatoid arthritis
26225474 IL-35 Is Involved in the Pathogenesis of Guillain-Barre Syndrome Through Its Influence on the Function of CD4+ T Cells
26204444 Elevated circulating IL-35, particularly at early phase, its decrease after treatment initiation, and a positive association between synovial fluid IL-35 and disease activity support an involvement of IL-35 in the pathogenesis of RA.
26104769 Gene-gene interaction analysis showed that subjects carrying the IL-12A rs568408AG/AA and IL-12B rs3212227AA genotypes had a 2.40-fold increased risk of CRC (OR = 2.40; 95 % CI, 1.14-5.07)
26085094 Insight into the control of vascular inflammation by IL-35.
More...

AA Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEID      1 - 70
HEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKT     71 - 140
MNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTID    141 - 210
RVMSYLNAS                                                                 211 - 219
//

Text Mined References (305)

PMID Year Title
26966064 2016 Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells.
26960148 2016 Exogenous Thyropin from p41 Invariant Chain Diminishes Cysteine Protease Activity and Affects IL-12 Secretion during Maturation of Human Dendritic Cells.
26514528 2015 Assessment of Relationship between Wilms' Tumor Gene (WT1) Expression in Peripheral Blood of Acute Leukemia Patients and Serum IL-12 and C3 Levels.
26431888 2015 Elevated IL-35 in bone marrow of the patients with acute myeloid leukemia.
26375522 2015 Association between polymorphisms of interleukin 12 and rheumatoid arthritis associated biomarkers in a Chinese population.
26370008 2015 Low Serum Levels of Interleukin 35 in Patients with Rheumatoid Arthritis.
26225474 2015 IL-35 Is Involved in the Pathogenesis of Guillain-Barré Syndrome Through Its Influence on the Function of CD4+ T Cells.
26204444 2015 Interleukin 35 Synovial Fluid Levels Are Associated with Disease Activity of Rheumatoid Arthritis.
26104769 2015 Interaction analysis of IL-12A and IL-12B polymorphisms with the risk of colorectal cancer.
26085094 2015 Interleukin-35 Inhibits Endothelial Cell Activation by Suppressing MAPK-AP-1 Pathway.
More...