Property Summary

Ligand Count 48
NCBI Gene PubMed Count 48
PubMed Score 353.30
PubTator Score 534.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma 1.200 4.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.095 1.2e-03
chronic lymphosyte leukemia -1.500 1.5e-12
colon cancer 1.200 6.8e-05
ductal carcinoma in situ -1.300 3.0e-03
intraductal papillary-mucinous adenoma (... -1.500 5.5e-04
intraductal papillary-mucinous neoplasm ... -1.400 4.4e-03
invasive ductal carcinoma -1.200 2.4e-02
lung adenocarcinoma 1.297 6.3e-07
lung cancer 1.500 1.2e-04
lung carcinoma -1.200 1.1e-19
medulloblastoma, large-cell 1.100 1.9e-02
Multiple myeloma 1.303 3.5e-03
non-small cell lung cancer 1.271 9.6e-08
osteosarcoma -2.160 2.5e-04
ovarian cancer 1.400 3.1e-03
pancreatic cancer -1.100 1.8e-02
primary pancreatic ductal adenocarcinoma -1.075 1.1e-02
sonic hedgehog group medulloblastoma 1.100 2.9e-04
tuberculosis 1.200 1.7e-05

Gene RIF (18)

AA Sequence

MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR      1 - 70
FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK     71 - 140
YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG    141 - 210
WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS    211 - 280
KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI    281 - 350
FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS    351 - 420
IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG    421 - 490
QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE    491 - 560
DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA           561 - 623
//

Text Mined References (60)

PMID Year Title