Property Summary

NCBI Gene PubMed Count 46
Grant Count 102
R01 Count 67
Funding $35,659,288.55
PubMed Score 355.71
PubTator Score 534.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P29401 A8K089 B4DE31 E7EPA7 Q8TBA3 Q96HH3 TK
Symbols TK
TKT1
SDDHD
HEL107
HEL-S-48

Gene

TKT

PANTHER Protein Class (2)

PDB

3MOS   3OOY   4KXU   4KXV   4KXW   4KXX   4KXY  

Gene RIF (16)

PMID Text
26811478 transketolase (TKT)is required for cancer growth because of its ability to affect the production of NAPDH to counteract oxidative stress.
25895698 Transketolase is upregulated in metastatic peritoneal implants and promotes ovarian cancer cell proliferation.
24981175 Akt1 phosphorylates TKT on Thr382, markedly enhancing enzyme activity.
24114639 basal TK activity was decreased in cases with diabetic neuropathy
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of transketolase (TKT) expression by HIV-1 Vpr in Vpr transduced macrophages
23492569 TKT rs3736156 identified significant differences in the onset of cardiovascular event in patients having genotypes AG + AA versus GG
23261987 Data indicate that transketolase (hTKT). shares 61% sequence identity with transketolase-like protein (TKTL1).
23118983 No transketolase activity of TKTDelta38 can be detected for conversion of physiological sugar substrates thus arguing against an intrinsically encoded enzymatic function of TKTL1 in tumor cell metabolism
22944692 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of transketolase (TKT) expression by HIV-1 Vpr in Vpr transduced macrophages
22645655 Structure and function of the transketolase from Mycobacterium tuberculosis and comparison with the human enzyme.
More...

AA Sequence

MESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVLFFHTMRYKSQDPRNPHNDR      1 - 70
FVLSKGHAAPILYAVWAEAGFLAEAELLNLRKISSDLDGHPVPKQAFTDVATGSLGQGLGAACGMAYTGK     71 - 140
YFDKASYRVYCLLGDGELSEGSVWEAMAFASIYKLDNLVAILDINRLGQSDPAPLQHQMDIYQKRCEAFG    141 - 210
WHAIIVDGHSVEELCKAFGQAKHQPTAIIAKTFKGRGITGVEDKESWHGKPLPKNMAEQIIQEIYSQIQS    211 - 280
KKKILATPPQEDAPSVDIANIRMPSLPSYKVGDKIATRKAYGQALAKLGHASDRIIALDGDTKNSTFSEI    281 - 350
FKKEHPDRFIECYIAEQNMVSIAVGCATRNRTVPFCSTFAAFFTRAFDQIRMAAISESNINLCGSHCGVS    351 - 420
IGEDGPSQMALEDLAMFRSVPTSTVFYPSDGVATEKAVELAANTKGICFIRTSRPENAIIYNNNEDFQVG    421 - 490
QAKVVLKSKDDQVTVIGAGVTLHEALAAAELLKKEKINIRVLDPFTIKPLDRKLILDSARATKGRILTVE    491 - 560
DHYYEGGIGEAVSSAVVGEPGITVTHLAVNRVPRSGKPAELLKMFGIDRDAIAQAVRGLITKA           561 - 623
//

Text Mined References (57)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26811478 2016 Transketolase counteracts oxidative stress to drive cancer development.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895698 2015 Transketolase is upregulated in metastatic peritoneal implants and promotes ovarian cancer cell proliferation.
24981175 2014 Akt phosphorylation and regulation of transketolase is a nodal point for amino acid control of purine synthesis.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114639 2013 Erythrocyte transketolase activity in patients with diabetic and alcoholic neuropathies.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23492569 2014 Genetic variability in enzymes of metabolic pathways conferring protection against non-enzymatic glycation versus diabetes-related morbidity and mortality.
More...