Property Summary

NCBI Gene PubMed Count 131
PubMed Score 275.74
PubTator Score 285.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Alport Syndrome, X-Linked 1 0.0 0.0
Leiomyoma, Epithelioid 2 0.0 0.0
Disease Target Count Z-score Confidence
Alport syndrome 21 8.447 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.253 2.6e-02
atypical teratoid / rhabdoid tumor 2.000 3.8e-05
breast carcinoma 1.400 1.1e-02
cutaneous lupus erythematosus -1.200 3.0e-02
Down syndrome 1.600 2.3e-03
ductal carcinoma in situ 1.300 3.9e-02
ependymoma 1.700 7.5e-07
fibroadenoma 2.300 2.4e-02
group 4 medulloblastoma -2.700 8.7e-05
inflammatory breast cancer -1.600 1.1e-02
interstitial cystitis -1.200 2.5e-04
lung adenocarcinoma -1.300 3.9e-04
lung cancer 3.100 3.0e-04
malignant mesothelioma -1.400 4.0e-05
nasopharyngeal carcinoma 1.500 3.9e-02
ovarian cancer -3.100 1.6e-08
Pick disease -1.700 3.6e-03
pituitary cancer -2.700 4.3e-05
progressive supranuclear palsy -1.800 3.0e-02
psoriasis 1.500 1.3e-03

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (80)

AA Sequence

MKLRGVSLAAGLFLLALSLWGQPAEAAACYGCSPGSKCDCSGIKGEKGERGFPGLEGHPGLPGFPGPEGP      1 - 70
PGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQGIPGCNGTKGERGFPGSPGFP     71 - 140
GLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPGIQGLPGPTGIPGPIGPPGPPGLMGPPGPPG    141 - 210
LPGPKGNMGLNFQGPKGEKGEQGLQGPPGPPGQISEQKRPIDVEFQKGDQGLPGDRGPPGPPGIRGPPGP    211 - 280
PGGEKGEKGEQGEPGKRGKPGKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGDTGPPGPPGLVIPRPG    281 - 350
TGITIGEKGNIGLPGLPGEKGERGFPGIQGPPGLPGPPGAAVMGPPGPPGFPGERGQKGDEGPPGISIPG    351 - 420
PPGLDGQPGAPGLPGPPGPAGPHIPPSDEICEPGPPGPPGSPGDKGLQGEQGVKGDKGDTCFNCIGTGIS    421 - 490
GPPGQPGLPGLPGPPGSLGFPGQKGEKGQAGATGPKGLPGIPGAPGAPGFPGSKGEPGDILTFPGMKGDK    491 - 560
GELGSPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGITFKGERGPPGNPGLPGLPGNIGPMGPPGFGPPGP    561 - 630
VGEKGIQGVAGNPGQPGIPGPKGDPGQTITQPGKPGLPGNPGRDGDVGLPGDPGLPGQPGLPGIPGSKGE    631 - 700
PGIPGIGLPGPPGPKGFPGIPGPPGAPGTPGRIGLEGPPGPPGFPGPKGEPGFALPGPPGPPGLPGFKGA    701 - 770
LGPKGDRGFPGPPGPPGRTGLDGLPGPKGDVGPNGQPGPMGPPGLPGIGVQGPPGPPGIPGPIGQPGLHG    771 - 840
IPGEKGDPGPPGLDVPGPPGERGSPGIPGAPGPIGPPGSPGLPGKAGASGFPGTKGEMGMMGPPGPPGPL    841 - 910
GIPGRSGVPGLKGDDGLQGQPGLPGPTGEKGSKGEPGLPGPPGPMDPNLLGSKGEKGEPGLPGIPGVSGP    911 - 980
KGYQGLPGDPGQPGLSGQPGLPGPPGPKGNPGLPGQPGLIGPPGLKGTIGDMGFPGPQGVEGPPGPSGVP    981 - 1050
GQPGSPGLPGQKGDKGDPGISSIGLPGLPGPKGEPGLPGYPGNPGIKGSVGDPGLPGLPGTPGAKGQPGL   1051 - 1120
PGFPGTPGPPGPKGISGPPGNPGLPGEPGPVGGGGHPGQPGPPGEKGKPGQDGIPGPAGQKGEPGQPGFG   1121 - 1190
NPGPPGLPGLSGQKGDGGLPGIPGNPGLPGPKGEPGFHGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP   1191 - 1260
GRPGLPGPEGPPGLPGNGGIKGEKGNPGQPGLPGLPGLKGDQGPPGLQGNPGRPGLNGMKGDPGLPGVPG   1261 - 1330
FPGMKGPSGVPGSAGPEGEPGLIGPPGPPGLPGPSGQSIIIKGDAGPPGIPGQPGLKGLPGPQGPQGLPG   1331 - 1400
PTGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGTRGLDGPPGPDGLQGPPGPPGTSSVAHGFLITRHSQT   1401 - 1470
TDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLS   1471 - 1540
TPEPMPMSMQPLKGQSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGS   1541 - 1610
GQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTRISRCQV   1611 - 1680
CMKRT                                                                    1681 - 1685
//

Text Mined References (133)

PMID Year Title