Property Summary

NCBI Gene PubMed Count 15
PubMed Score 272.50
PubTator Score 251.06

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEF      1 - 70
QVLVKKISQ                                                                  71 - 79
//

Text Mined References (15)

PMID Year Title