Property Summary

NCBI Gene PubMed Count 15
Grant Count 31
R01 Count 22
Funding $3,181,400.56
PubMed Score 272.51
PubTator Score 251.06

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
23132313 Addition of short-chain fatty acids to cultured Caco-2 cells results in elevation of calbindin-D9k mRNA.
20214988 cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol
17712966 Parathyroid hormone may inhibit or counteract the increase in CaBP-D9k mRNA caused by 1,25-(OH)2-D3 in Caco-2 cells.
15217781 Cdx-2 is a permissive factor that influences basal CaBP expression in enterocytes and that HNF-1alpha modulates CaBP gene expression during cellular differentiation.

AA Sequence

MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEF      1 - 70
QVLVKKISQ                                                                  71 - 79
//

Text Mined References (15)

PMID Year Title
23132313 2012 Short-chain fatty acids increase the level of calbindin-D9k messenger RNA in Caco-2 cells.
20214988 2010 Effects of calcitriol on calbindins gene expression and lipid peroxidation in human placenta.
17712966 2007 [Effect of parathyroid hormone and 1,25-(OH)2-D3 on the expression of the mRNA of calbindin D9k in Caco-2 cells].
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217781 2004 Control of differentiation-induced calbindin-D9k gene expression in Caco-2 cells by cdx-2 and HNF-1alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10417310 1999 Factors involved in the duodenal expression of the human calbindin-D9k gene.
8308886 1994 The human calbindin-D9k gene. Complete structure and implications on steroid hormone regulation.
More...