Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.27
PubTator Score 35.27

Knowledge Summary

Patent (4,901)

TINX Plot

  Disease Sources (4)

Disease Target Count
non-small cell lung cancer 2798
Disease Target Count P-value
ovarian cancer 8492 7.87563919345126E-6
medulloblastoma 1524 2.93204118982337E-5
ulcerative colitis 2087 5.89008414549411E-5
atypical teratoid / rhabdoid tumor 4369 1.91117771974743E-4
medulloblastoma, large-cell 6234 0.0010929636255182
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00460740579399922
Disease Target Count Z-score Confidence
systemic lupus erythematosus 172 0.0 4.0

Expression

  Differential Expression (6)

Synonym

Accession P29376 A6NNJ8 B4DL89 E9PFX4
Symbols TYK1

Gene

LTK

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
25331893 Only two related secreted factors, FAM150A and FAM150B (family with sequence similarity 150 member A and member B), stimulated LTK phosphorylation.
22347506 aberrant activation of LTK may contribute to neoplastic cell growth.
14695357 polymorphic LTKs cause up-regulation of the PI3K pathway and possibly form one genetic component of susceptibility to abnormal proliferation of self-reactive B cells in systemic lupus erythematosus

AA Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLNSPGTEGSWLF      1 - 70
STCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAH     71 - 140
GVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGG    141 - 210
GGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSR    211 - 280
APSPQAGRSLQEGAEGGQGCSEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGV    281 - 350
SFIHPSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK    351 - 420
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTAPNPYYCQVGL    421 - 490
GPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLM    491 - 560
EALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQDIAQG    561 - 630
CHYLEENHFIHRDIAARNCLLSCAGPSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIF    631 - 700
TSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSF    701 - 770
ASILERLQYCTQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL    771 - 840
SSGLKPLKSRGLQPQNLWNPTYRS                                                  841 - 864
//

Text Mined References (28)

PMID Year Title
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
25331893 2014 Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.
22347506 2012 ALK-activating homologous mutations in LTK induce cellular transformation.
20548102 2010 MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
18849880 2008 Expression of a chimeric CSF1R-LTK mediates ligand-dependent neurite outgrowth.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...