Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 5
Funding $335,187.2
PubMed Score 12.27
PubTator Score 35.27

Knowledge Summary

Patent (4,901)

Expression

  Differential Expression (6)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
25331893 Only two related secreted factors, FAM150A and FAM150B (family with sequence similarity 150 member A and member B), stimulated LTK phosphorylation.
22347506 aberrant activation of LTK may contribute to neoplastic cell growth.
14695357 polymorphic LTKs cause up-regulation of the PI3K pathway and possibly form one genetic component of susceptibility to abnormal proliferation of self-reactive B cells in systemic lupus erythematosus

AA Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLNSPGTEGSWLF      1 - 70
STCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAH     71 - 140
GVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGG    141 - 210
GGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSR    211 - 280
APSPQAGRSLQEGAEGGQGCSEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGV    281 - 350
SFIHPSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK    351 - 420
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTAPNPYYCQVGL    421 - 490
GPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLM    491 - 560
EALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQDIAQG    561 - 630
CHYLEENHFIHRDIAARNCLLSCAGPSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIF    631 - 700
TSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSF    701 - 770
ASILERLQYCTQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL    771 - 840
SSGLKPLKSRGLQPQNLWNPTYRS                                                  841 - 864
//

Text Mined References (28)

PMID Year Title
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
25331893 2014 Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome.
22347506 2012 ALK-activating homologous mutations in LTK induce cellular transformation.
20548102 2010 MAPK signaling to the early secretory pathway revealed by kinase/phosphatase functional screening.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
18849880 2008 Expression of a chimeric CSF1R-LTK mediates ligand-dependent neurite outgrowth.
17910947 2007 Identification of twinfilin-2 as a factor involved in neurite outgrowth by RNAi-based screen.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...