Property Summary

Ligand Count 9
NCBI Gene PubMed Count 22
PubMed Score 12.65
PubTator Score 35.27

Knowledge Summary

Patent (4,901)

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
intraductal papillary-mucinous adenoma (... 1.100 4.6e-03
medulloblastoma -1.100 2.9e-05
medulloblastoma, large-cell -1.100 1.1e-03
ovarian cancer -1.100 7.9e-06
ulcerative colitis -1.300 5.9e-05

Gene RIF (4)

AA Sequence

MGCWGQLLVWFGAAGAILCSSPGSQETFLRSSPLPLASPSPRDPKVSAPPSILEPASPLNSPGTEGSWLF      1 - 70
STCGASGRHGPTQTQCDGAYAGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAH     71 - 140
GVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGG    141 - 210
GGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSEAPGSGGRGGAAGGGGGWTSR    211 - 280
APSPQAGRSLQEGAEGGQGCSEAWATLGWAAAGGFGGGGGACTAGGGGGGYRGGDASETDNLWADGEDGV    281 - 350
SFIHPSSELFLQPLAVTENHGEVEIRRHLNCSHCPLRDCQWQAELQLAECLCPEGMELAVDNVTCMDLHK    351 - 420
PPGPLVLMVAVVATSTLSLLMVCGVLILVKQKKWQGLQEMRLPSPELELSKLRTSAIRTAPNPYYCQVGL    421 - 490
GPAQSWPLPPGVTEVSPANVTLLRALGHGAFGEVYEGLVIGLPGDSSPLQVAIKTLPELCSPQDELDFLM    491 - 560
EALIISKFRHQNIVRCVGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQDIAQG    561 - 630
CHYLEENHFIHRDIAARNCLLSCAGPSRVAKIGDFGMARDIYRASYYRRGDRALLPVKWMPPEAFLEGIF    631 - 700
TSKTDSWSFGVLLWEIFSLGYMPYPGRTNQEVLDFVVGGGRMDPPRGCPGPVYRIMTQCWQHEPELRPSF    701 - 770
ASILERLQYCTQDPDVLNSLLPMELGPTPEEEGTSGLGNRSLECLRPPQPQELSPEKLKSWGGSPLGPWL    771 - 840
SSGLKPLKSRGLQPQNLWNPTYRS                                                  841 - 864
//

Text Mined References (28)

PMID Year Title