Property Summary

NCBI Gene PubMed Count 69
PubMed Score 175.76
PubTator Score 137.26

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (16)

Disease log2 FC p
breast carcinoma 1.100 2.9e-02
ductal carcinoma in situ 2.200 2.1e-04
Endometriosis 1.060 3.7e-02
esophageal adenocarcinoma -3.100 2.0e-02
facioscapulohumeral dystrophy 1.700 4.7e-02
group 3 medulloblastoma 1.600 2.3e-02
interstitial cystitis -1.500 2.7e-03
invasive ductal carcinoma 2.800 3.6e-04
lung adenocarcinoma 1.700 6.8e-06
lung cancer 2.600 1.9e-06
malignant mesothelioma 1.100 1.3e-05
non-small cell lung cancer 2.365 4.4e-15
osteosarcoma 1.989 2.3e-02
ovarian cancer 2.600 1.6e-06
pituitary cancer 1.700 5.9e-04
psoriasis 1.500 1.0e-07

Gene RIF (40)

AA Sequence

MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE      1 - 70
EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE       71 - 138
//

Text Mined References (73)

PMID Year Title