Property Summary

Ligand Count 1
NCBI Gene PubMed Count 72
PubMed Score 687.54
PubTator Score 424.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.670 1.6e-09
spina bifida 1.040 1.6e-02

Protein-protein Interaction (4)

Gene RIF (53)

AA Sequence

MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGP      1 - 70
YRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGG     71 - 140
RQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLK    141 - 210
DRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVR    211 - 280
GSPWVSVVDRVAEQDTQA                                                        281 - 298
//

Text Mined References (75)

PMID Year Title