Property Summary

NCBI Gene PubMed Count 69
Grant Count 115
R01 Count 83
Funding $17,545,860.66
PubMed Score 653.53
PubTator Score 424.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.670 0.000
spina bifida 1.040 0.016

Synonym

Accession P29372 G5E9E2 Q13770 Q15275 Q15961 Q5J9I4 Q96BZ6 Q96S33 Q9NNX5
Symbols AAG
MDG
ADPG
APNG
Mid1
anpg
PIG11
PIG16
CRA36.1

Gene

MPG

PDB

1BNK   1EWN   1F4R   1F6O   3QI5   3UBY  

 IMPC Term (1)

Gene RIF (50)

PMID Text
26025911 Role of MPG protein in the DNA damage response through the base excision repair pathway
25757089 Rheumatoid arthritis is associated with a polymorphism in the MPG gene (rs2858056) and increased serum level of the MPG protein.
25538240 results suggest that individuals carrying R120C and R141Q MPG variants may be at risk for genomic instability and associated diseases as a consequence.
25355292 High MPG DNA repair assays for two different oxidative DNA lesions reveal associations with increased lung cancer risk.
25324304 In the case of alkyladenine DNA glycosylase, DNA intercalation contributes to the specific binding of a damaged nucleotide, but this enhanced specificity comes at the cost of reduced speed of nucleotide flipping.
23839988 AAG has a flexible amino terminus that tunes its affinity for nonspecific DNA, but we find that it is not required for intersegmental transfer. As AAG has only a single DNA binding site, this argues against the bridging model for intersegmental transfer
23688261 AAG removes both methanol and 1,N(6)-ethenoadenine from DNA with single-turnover rate constants that are significantly greater than the corresponding uncatalyzed rates.
23537643 UHRF1 interacts with N-methylpurine DNA glycosylase (MPG) in cancer cells in vitro and displays a co-localization with MPG in the nucleoplasm.
23290262 Mitochondrial single-stranded binding protein (mtSSB) as a novel interacting partner of AAG.
23137018 disease-stage-specific alterations in the expression of MPG may highlight a potential role for MPG in determining EAC onset and thus potentially be of clinical relevance for early disease detection and increased patient survival.
More...

AA Sequence

MVTPALQMKKPKQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGP      1 - 70
YRSIYFSSPKGHLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGG     71 - 140
RQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLK    141 - 210
DRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVR    211 - 280
GSPWVSVVDRVAEQDTQA                                                        281 - 298
//

Text Mined References (72)

PMID Year Title
26025911 2015 Initiation of the ATM-Chk2 DNA damage response through the base excision repair pathway.
25757089 2015 Effect of MPG gene rs2858056 polymorphism, copy number variation, and level of serum MPG protein on the risk for rheumatoid arthritis.
25538240 2015 Germ line variants of human N-methylpurine DNA glycosylase show impaired DNA repair activity and facilitate 1,N6-ethenoadenine-induced mutations.
25416956 2014 A proteome-scale map of the human interactome network.
25355292 2014 Enzymatic MPG DNA repair assays for two different oxidative DNA lesions reveal associations with increased lung cancer risk.
25324304 2014 Critical role of DNA intercalation in enzyme-catalyzed nucleotide flipping.
23839988 2013 Isolating contributions from intersegmental transfer to DNA searching by alkyladenine DNA glycosylase.
23688261 2013 DNA-N-glycosylases process novel O-glycosidic sites in DNA.
23537643 2013 Identification of UHRF1/2 as new N-methylpurine DNA glycosylase-interacting proteins.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
More...