Property Summary

NCBI Gene PubMed Count 46
Grant Count 70
R01 Count 46
Funding $7,973,819.79
PubMed Score 215.15
PubTator Score 127.21

Knowledge Summary

Patent (16,251)

Synonym

Accession P29371 Q0P510 NKR
Symbols NKR
HH11
NK3R
NK-3R
TAC3RL

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (30)

PMID Text
25452470 Elevated CRP is likely a pathogenic factor contributing to preeclampsia by binding to phosphocholinated neurokinin B and preferentially activating NK3R.
25153567 None of the 4 single polymorphisms studied in TACR3 are linked directly to puberty onset time, but A63P in TAC3 is statistically associated with precocious puberty.
24802197 mutations in TAC and TACR3 are not a common cause for ICPP.
24434351 data indicate that GPR54 and TACR3 gene mutations are not a frequent cause of ICPP. The identified A/G synonymous SNP (dbSNP ID: rs10407968) located in exon 1 of the gene is not likely to have a pathogenic role in exon splicing
24376026 Studies indicate the molecular mechanisms by which NK3R mutations cause GnRH deficiency.
23983264 the rs2765 SNP predicted the degree of impairment of learning and memory in 209 elderly patients with cognitive impairments
23656837 Expression of the gene encoding TACR3 is significantly up-regulated in leiomyomas, compared with matched myometrium.
23329188 Rare variants in the TAC3 and TACR3 genes were identified in patients with central pubertal disorders and loss-of-function variants of TACR3 were associated with the normosmic IHH phenotype.
23019350 Sex differences in the neurokinin B system in the human infundibular nucleus.
22766261 Data suggest that mutations in TACR3 and GNRHR are the most common causative mutations in normosmic idiopathic hypogonadotropic hypogonadism in families in Turkey.
More...

AA Sequence

MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQP      1 - 70
WANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTL     71 - 140
VNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWIL    141 - 210
AFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIP    211 - 280
GDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTM    281 - 350
YNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT    351 - 420
TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS                             421 - 465
//

Text Mined References (47)

PMID Year Title
25452470 2015 Neurokinin 3 receptor and phosphocholine transferase: missing factors for pathogenesis of C-reactive protein in preeclampsia.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25153567 2015 Association study of TAC3 and TACR3 gene polymorphisms with idiopathic precocious puberty in Chinese girls.
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
24802197 2014 Mutational analysis of TAC and TACR3 in idiopathic central precocious puberty.
24434351 2014 Absence of GPR54 and TACR3 mutations in sporadic cases of idiopathic central precocious puberty.
24376026 2014 TACR3 mutations disrupt NK3R function through distinct mechanisms in GnRH-deficient patients.
23983264 2013 Neurokinin3 receptor as a target to predict and improve learning and memory in the aged organism.
23656837 2013 Differentially regulated expression of neurokinin B (NKB)/NK3 receptor system in uterine leiomyomata.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
More...