Property Summary

Ligand Count 3
NCBI Gene PubMed Count 323
PubMed Score 598.09
PubTator Score 478.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 2.000 2.6e-02
atypical teratoid / rhabdoid tumor 1.700 5.0e-04
glioblastoma 2.500 2.2e-03
group 4 medulloblastoma -1.700 5.8e-06
juvenile dermatomyositis 1.132 5.5e-12
Multiple myeloma 1.234 9.6e-03
ovarian cancer 3.000 1.7e-08
pediatric high grade glioma 1.100 7.7e-03
pituitary cancer -1.200 4.2e-05
primary pancreatic ductal adenocarcinoma 1.006 1.8e-02
subependymal giant cell astrocytoma 2.302 2.4e-03

Protein-protein Interaction (7)

PDB (11)

Gene RIF (141)

AA Sequence

MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRL      1 - 70
ANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSF     71 - 140
VNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRK    141 - 210
PCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKD    211 - 280
PVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY    281 - 350
NDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE    351 - 420
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFH    421 - 490
GKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHM    491 - 560
DNHLPIISAGSELCLQQPVERKL                                                   561 - 583
//

Text Mined References (350)

PMID Year Title