Property Summary

NCBI Gene PubMed Count 316
Grant Count 253
R01 Count 180
Funding $15,617,516.1
PubMed Score 586.63
PubTator Score 478.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Gene

PANTHER Protein Class (1)

PDB

1SHC   5CZI   1QG1   2L1C   1MIL   1N3H   1OY2   1TCE   1WCP   4JMH   4XWX  

Gene RIF (135)

PMID Text
26680585 Data suggest SHC1 (SH2 domain protein C1) expression down-regulates epithelial-mesenchymal transition by repressing TGFB-induced SMAD2/3 activation through differential partitioning of receptors at cell surface of mammocytes/keratinocytes.
26551075 Finally, a crystal structure of EGFR in complex with a primed Shc1 peptide reveals the structural basis for EGFR substrate specificity.
26464652 The silence of p66(Shc) in HCT8 cells reduced the proliferation and accelerated the apoptosis, in addition, the expression of pro-apoptotic proteins caspase-3, caspase-9, Bax was enhanced and the expression of anti-apoptotic protein Bcl-2 was declined.
26122877 In mice and humans, reduced p66Shc levels protect from obesity, but not from ectopic fat accumulation, glucose intolerance and insulin resistance.
25961473 These data demonstrate that the p52Shc phosphorylation level is altered by the solution environment without affecting the fraction of active c-Src.
25815500 Hyperoxia can increase the expression of PKCbeta in alveolar epithelial cells and production of mitochondrial reactive oxygen species and decrease mitochondrial membrane potential.
25810038 p53-dependent augmentation of p66(Shc) expression and function represents a key signalling response contributing to beta cell apoptosis under conditions of lipotoxicity
25680868 p66ShcA was upregulated in hearts of patients with ischemic heart disease without heart failure
25217205 Data show that ouabain-induced glioblastoma cells apoptosis and increased reactive oxygen species (ROS) generation in extracellular signal-related kinases ERK1/2-Shc signaling adaptor protein p66SHC-dependent pathway.
25147340 p66(Shc) plays a vital part in canonical Wnt signaling in the endothelium and mediates Wnt3a-stimulated endothelial oxidative stress and dysfunction.
More...

AA Sequence

MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRL      1 - 70
ANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSF     71 - 140
VNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRK    141 - 210
PCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKD    211 - 280
PVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYY    281 - 350
NDFPGKEPPLGGVVDMRLREGAAPGAARPTAPNAQTPSHLGATLPVGQPVGGDPEVRKQMPPPPPCPGRE    351 - 420
LFDDPSYVNVQNLDKARQAVGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVSMAEQLRGEPWFH    421 - 490
GKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHM    491 - 560
DNHLPIISAGSELCLQQPVERKL                                                   561 - 583
//

Text Mined References (343)

PMID Year Title
26680585 2015 ShcA Protects against Epithelial-Mesenchymal Transition through Compartmentalized Inhibition of TGF-?-Induced Smad Activation.
26551075 2015 EGF-receptor specificity for phosphotyrosine-primed substrates provides signal integration with Src.
26464652 2015 The silence of p66(Shc) in HCT8 cells inhibits the viability via PI3K/AKT/Mdm-2/p53 signaling pathway.
26122877 2015 p66Shc deletion or deficiency protects from obesity but not metabolic dysfunction in mice and humans.
25961473 2015 Conformation-Dependent Human p52Shc Phosphorylation by Human c-Src.
25815500 2015 [Roles of PKC?/P66Shc oxidative stress signal pathway in mediating hyperoxia-induced ROS production in alveolar epithelial cells].
25810038 2015 The p66(Shc) redox adaptor protein is induced by saturated fatty acids and mediates lipotoxicity-induced apoptosis in pancreatic beta cells.
25680868 2015 The p66ShcA adaptor protein regulates healing after myocardial infarction.
25416956 2014 A proteome-scale map of the human interactome network.
25217205 2015 Ouabain elicits human glioblastoma cells apoptosis by generating reactive oxygen species in ERK-p66SHC-dependent pathway.
More...