Property Summary

NCBI Gene PubMed Count 313
Grant Count 566
R01 Count 375
Funding $64,632,480.9
PubMed Score 171.23
PubTator Score 429.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
osteosarcoma -4.599 0.000
tuberculosis 1.200 0.000
non-small cell lung cancer -1.052 0.000
lung cancer -1.200 0.003
primary Sjogren syndrome 1.400 0.019
subependymal giant cell astrocytoma 1.190 0.020
spina bifida 1.035 0.041
ovarian cancer 1.100 0.000

Synonym

Accession P29350 A8K306 G3V0F8 Q969V8 Q9UK67
Symbols HCP
HCPH
SHP1
SHP-1
HPTP1C
PTP-1C
SHP-1L
SH-PTP1

Gene

PDB

2RMX   2YU7   4GS0   1FPR   1GWZ   1X6C   2B3O   3PS5   4GRY   4GRZ   4HJP   4HJQ  

Gene RIF (140)

PMID Text
26878112 In addition to their role in NK cell activation by hematopoietic cells, the SLAM-SAP-SHP1 pathways influence responsiveness toward nonhematopoietic targets by a process akin to NK cell 'education'.
26781335 Quinalizarin enhances radiosensitivity of nasopharyngeal carcinoma cells partially by suppressing SHP-1 expression
26679051 A combination of sorafenib and SC-43 is a synergistic SHP-1 agonist duo which reduces tumor size and prolonged survival time.
26597461 Data demonstrate for the first time that SHP1 methylation has high specificity for diagnosis of endometrial carcinoma, while CDH13 promoter methylation plays a role in the earlier stage.
26565811 N225K and A550V PTPN6 mutations cause loss-of-function leading to JAK3 mediated deregulation of STAT3 pathway and uncover a mechanism that tumor cells can use to control PTPN6 substrate specificity.
26473472 MiR-378g enhanced radiosensitivity partially by targeting SHP-1 in NPC cells.
26334669 cAMP signalling of Bordetella adenylate cyclase toxin through the SHP-1 phosphatase activates the BimEL-Bax pro-apoptotic cascade in phagocytes.
26215037 SHP-1 has a critical role in radioresistance, cell cycle progression, and senescence of nasopharyngeal carcinoma cells
26081980 miR-4649-3p is downregulated in nasopharyngeal carcinoma cell lines accompanied with SHP-1 upregulation.
25962492 Phosphorylation of ATR and CHK1 did not show significant differences in the three cell groups. Overexpression of SHP-1 in the CNE-2 cells led to radioresistance and the radioresistance was related to enhanced DNA DSB repair.
More...

AA Sequence

MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEKFA      1 - 70
TLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLS     71 - 140
QPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLR    141 - 210
QPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNIL    211 - 280
PFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMT    281 - 350
TREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH    351 - 420
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQM    421 - 490
VRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHK    491 - 560
EDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK                                       561 - 595
//

Text Mined References (323)

PMID Year Title
26878112 2016 A hematopoietic cell-driven mechanism involving SLAMF6 receptor, SAP adaptors and SHP-1 phosphatase regulates NK cell education.
26781335 2016 Quinalizarin enhances radiosensitivity of nasopharyngeal carcinoma cells partially by suppressing SHP-1 expression.
26679051 2016 A combination of sorafenib and SC-43 is a synergistic SHP-1 agonist duo to advance hepatocellular carcinoma therapy.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26565811 2015 Loss of function mutations in PTPN6 promote STAT3 deregulation via JAK3 kinase in diffuse large B-cell lymphoma.
26473472 2015 MicroRNA-378g enhanced radiosensitivity of NPC cells partially by targeting protein tyrosine phosphatase SHP-1.
26334669 2016 cAMP signalling of Bordetella adenylate cyclase toxin through the SHP-1 phosphatase activates the BimEL-Bax pro-apoptotic cascade in phagocytes.
26215037 2015 Increased SHP-1 expression results in radioresistance, inhibition of cellular senescence, and cell cycle redistribution in nasopharyngeal carcinoma cells.
26081980 2015 MicroRNA-4649-3p inhibits cell proliferation by targeting protein tyrosine phosphatase SHP-1 in nasopharyngeal carcinoma cells.
25962492 2015 SHP-1 overexpression increases the radioresistance of NPC cells by enhancing DSB repair, increasing S phase arrest and decreasing cell apoptosis.
More...