Property Summary

Ligand Count 14
NCBI Gene PubMed Count 342
PubMed Score 178.24
PubTator Score 429.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (9)

Disease log2 FC p
lung cancer -1.200 2.6e-03
malignant mesothelioma 1.500 2.9e-05
non-small cell lung cancer -1.052 1.9e-14
osteosarcoma -4.599 8.0e-09
ovarian cancer 1.100 1.8e-04
primary Sjogren syndrome 1.400 1.9e-02
spina bifida 1.035 4.1e-02
subependymal giant cell astrocytoma 1.190 2.0e-02
tuberculosis 1.200 8.6e-07

Protein-protein Interaction (2)

PDB (12)

Gene RIF (163)

AA Sequence

MVRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDFYDLYGGEKFA      1 - 70
TLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQAETLLQAKGEPWTFLVRESLS     71 - 140
QPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGIEEASGAFVYLR    141 - 210
QPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNIL    211 - 280
PFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMT    281 - 350
TREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDH    351 - 420
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQM    421 - 490
VRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHK    491 - 560
EDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK                                       561 - 595
//

Text Mined References (353)

PMID Year Title