Property Summary

Ligand Count 11
NCBI Gene PubMed Count 133
PubMed Score 498.47
PubTator Score 282.56

Knowledge Summary

Patent (187,111)

TINX Plot

  Disease (8)

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.063 2.7e-02
adult high grade glioma 1.300 3.0e-03
atypical teratoid / rhabdoid tumor 1.600 7.5e-04
colon cancer 1.300 5.3e-04
cutaneous lupus erythematosus 1.700 8.8e-03
cystic fibrosis 1.226 3.2e-04
glioblastoma 2.000 2.7e-06
group 3 medulloblastoma 2.000 9.7e-06
lung cancer 2.300 1.6e-04
malignant mesothelioma -4.100 6.6e-08
medulloblastoma, large-cell 1.600 2.0e-04
non-small cell lung cancer 1.078 2.6e-09
osteosarcoma 1.725 1.9e-04
primitive neuroectodermal tumor 1.400 7.6e-03
psoriasis 1.200 2.0e-09

Protein-protein Interaction (4)

Gene RIF (76)

AA Sequence

MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQN      1 - 70
NWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADFDSATKTFPNWMENPWVKVDT     71 - 140
IAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQDYGGCMSLIAVRVFYRKCPRIIQNGAIFQET    141 - 210
LSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKAN    211 - 280
QGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDS    281 - 350
GGREDLVYNIICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF    351 - 420
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPT    421 - 490
NTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEKLPLIIGSSAAGLVFLIAVVV    491 - 560
IAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAG    561 - 630
EFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITE    631 - 700
FMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRF    701 - 770
LEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE    771 - 840
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIP    841 - 910
DYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQ    911 - 980
IQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKEDSHKESND    981 - 1050
CSCGG                                                                    1051 - 1055
//

Text Mined References (137)

PMID Year Title