Property Summary

Ligand Count 10
NCBI Gene PubMed Count 28
PubMed Score 48.34
PubTator Score 69.98

Knowledge Summary

Patent (13,866)

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 2.600 2.2e-05
medulloblastoma, large-cell 1.500 1.4e-03
osteosarcoma 2.426 1.1e-08
ovarian cancer 1.200 1.0e-07
psoriasis 2.100 1.6e-16

Gene RIF (7)

AA Sequence

MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTY      1 - 70
QVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQES     71 - 140
QFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRN    141 - 210
LAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGF    211 - 280
YKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAP    281 - 350
PLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD    351 - 420
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTL    421 - 490
KAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLL    491 - 560
LICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAEPHTYEEPGRAGRSFTREI    561 - 630
EASRIHIEKIIGSGDSGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLE    631 - 700
GVVTRGRLAMIVTEYMENGSLDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDS    701 - 770
NLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW    771 - 840
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSR    841 - 910
CPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGH    911 - 980
QKKILGSIQTMRAQLTSTQGPRRHL                                                 981 - 1005
//

Text Mined References (32)

PMID Year Title