Property Summary

NCBI Gene PubMed Count 55
Grant Count 75
R01 Count 56
Funding $7,172,169.31
PubMed Score 237.02
PubTator Score 91.19

Knowledge Summary

Patent (35,988)

Expression

Synonym

Accession P29320 Q9H2V3 Q9H2V4
Symbols EK4
ETK
HEK
ETK1
HEK4
TYRO4

Gene

PDB

4L0P   2GSF   2QO2   2QO7   2QO9   2QOB   2QOC   2QOD   2QOF   2QOI   2QOK   2QOL   2QON   2QOO   2QOQ   3DZQ   3FXX   3FY2   4G2F   4GK2   4GK3   4GK4   4P4C   4P5Q   4P5Z   4TWN   4TWO  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
26552734 A novel association between the EPHA3 deletion and prostate cancer risk was observed in Finnish individuals.
26381449 This study showed that EPHA3 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.
26232493 EphA3 forms dimers in the absence of ligand binding.
25993310 the structure of the ligand-binding domain of the EphA3 receptor in complex with its preferred ligand, ephrin-A5, is reported.
25420155 Data indicate that hypoxia increased EphA3 receptor (EphA3) mRNA expression in EphA3+ endometrial multipotent mesenchymal stromal cells (eMSCs).
25231727 EphA3 was induced by PC-1 and contributed to the malignant progression of prostate cancer
23991104 Based on the knowledge that EPHA4 has been previously shown to rescue SOD1 transgenic mice from ALS phenotype and prolongs survival, EPHA3 may be a promising candidate for therepuetic interventions
23970317 EphA3 may represent a novel candidate marker for patient prognosis as well a molecular target for HCC therapy.
23410976 High EphA3 expression is associated with glioblastoma multiforme.
23324396 EPHA3 mutations may promote tumorigenesis only when key senescence-inducing pathways have been inactivated.
More...

AA Sequence

MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQV      1 - 70
CNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQF     71 - 140
TKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLA    141 - 210
MFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKA    211 - 280
LDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLD    281 - 350
TGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS    351 - 420
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRAR    421 - 490
GTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQVVMIAISAAVAIILLTVVI    491 - 560
YVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPHTYEDPTQAVHEFAKELDATNISIDKVVGAG    561 - 630
EFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTE    631 - 700
YMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRV    701 - 770
LEDDPEAAYTTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG    771 - 840
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSNLLLDQSNVDI    841 - 910
TTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVGPQKKIISSIKALETQSKNGP    911 - 980
VPV                                                                       981 - 983
//

Text Mined References (60)

PMID Year Title
26552734 2016 Germline copy number variation analysis in Finnish families with hereditary prostate cancer.
26381449 2015 The association of DNA methylation and brain volume in healthy individuals and schizophrenia patients.
26232493 2015 Unliganded EphA3 dimerization promoted by the SAM domain.
25993310 2015 Distinctive Structure of the EphA3/Ephrin-A5 Complex Reveals a Dual Mode of Eph Receptor Interaction for Ephrin-A5.
25420155 2014 Hypoxia-controlled EphA3 marks a human endometrium-derived multipotent mesenchymal stromal cell that supports vascular growth.
25231727 2014 EphA3, induced by PC-1/PrLZ, contributes to the malignant progression of prostate cancer.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23991104 2013 Genome-wide copy number variation in sporadic amyotrophic lateral sclerosis in the Turkish population: deletion of EPHA3 is a possible protective factor.
23970317 2013 High levels of EphA3 expression are associated with high invasive capacity and poor overall survival in hepatocellular carcinoma.
23410976 2013 EphA3 maintains tumorigenicity and is a therapeutic target in glioblastoma multiforme.
More...