Property Summary

NCBI Gene PubMed Count 213
Grant Count 217
R01 Count 108
Funding $38,788,974.73
PubMed Score 785.10
PubTator Score 341.83

Knowledge Summary

Patent (192,584)

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis 1.600 0.000
atypical teratoid / rhabdoid tumor 1.100 0.009
Atopic dermatitis 1.100 0.000
adrenocortical carcinoma -1.053 0.000
pancreatic ductal adenocarcinoma liver m... 1.795 0.007
intraductal papillary-mucinous neoplasm ... 2.100 0.004
sarcoidosis -1.100 0.037
pancreatic cancer 1.400 0.000
group 3 medulloblastoma 1.400 0.030
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma -1.200 0.000
spina bifida -1.840 0.048
Breast cancer -1.600 0.000
ulcerative colitis 2.000 0.000
ovarian cancer 1.600 0.000
chronic rhinosinusitis -1.171 0.037

Synonym

Accession P29317 B5A968 Q8N3Z2
Symbols ECK
CTPA
ARCC2
CTPP1
CTRCT6

Gene

PDB

2X11   3MX0   2KSO   3KKA   3CZU   3HEI   3MBW   1MQB   2E8N   2K9Y   2X10   3C8X   3FL7   3HPN   3SKJ   4P2K   4PDO   4TRL   5EK7  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (174)

PMID Text
26900323 Mis-localization of two of the mutant proteins in epithelial cells suggests that some disease-causing mutations in EPHA2 likely affect lens epithelial cell homeostasis and contribute to cataract.
26843134 These data suggest that miR-26b enhances the radiosensitivity of 97H hepatocellular cancer cells by targeting EphA2 protein.
26744526 Role for EPHA2 in the maintenance of cell survival of TKI-resistant, EGFR-mutant lung cancer and indicate that EPHA2 may serve as a useful therapeutic target in TKI-resistant tumors.
26722543 EphA2 protein may be used as a new marker for the prognosis of clear cell renal cell carcinoma.
26565750 Based on these findings we propose that EphA2 promotes cell adhesion by an unknown signaling pathway that largely depends on the extracellular region of EphA2 and the activation of outside-in integrin signaling
26363067 EphA2 forms dimers in the plasma membrane of HEK293T cells in the absence of ephrin ligand binding, suggesting that the current seeding mechanism model of EphA2 activation is incomplete.
26283684 EphA2 Expression Is a Key Driver of Migration and Invasion and a Poor Prognostic Marker in Colorectal Cancer
26191168 Overexpression of miR-26b dramatically inhibited the proliferation, invasion, and migration of hepatocellular carcinoma cells by targeting EphA2.
26177500 EphA2/FAK/RhoA signaling pathway plays a critical role in the malignant cellular behavior of renal cell carcinoma
26130649 Data show that ligand-binding domain of receptor tyrosine kinase EphA2 is cleaved frequently by the membrane metalloproteinase MT1-MMP.
More...

AA Sequence

MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVC      1 - 70
NVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFT     71 - 140
KIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAH    141 - 210
FPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGF    211 - 280
FKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTP    281 - 350
PQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG    351 - 420
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGF    421 - 490
SVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHR    491 - 560
RRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKG    561 - 630
MLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGAL    631 - 700
DKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEA    701 - 770
TYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM    771 - 840
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVS    841 - 910
EWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI        911 - 976
//

Text Mined References (228)

PMID Year Title
27385333 2016 Protein kinase A can block EphA2 receptor-mediated cell repulsion by increasing EphA2 S897 phosphorylation.
26900323 2016 EPHA2 MUTATIONS CONTRIBUTE TO CONGENITAL CATARACT THROUGH DIVERSE MECHANISMS.
26843134 2016 MicroRNA-26b Enhances the Radiosensitivity of Hepatocellular Carcinoma Cells by Targeting EphA2.
26744526 2016 EPHA2 Blockade Overcomes Acquired Resistance to EGFR Kinase Inhibitors in Lung Cancer.
26722543 2015 Expression of EphA2 protein is positively associated with age, tumor size and Fuhrman nuclear grade in clear cell renal cell carcinomas.
26565750 2015 EphA2 promotes cell adhesion and spreading of monocyte and monocyte/macrophage cell lines on integrin ligand-coated surfaces.
26363067 2015 EphA2 Receptor Unliganded Dimers Suppress EphA2 Pro-tumorigenic Signaling.
26283684 2016 EphA2 Expression Is a Key Driver of Migration and Invasion and a Poor Prognostic Marker in Colorectal Cancer.
26191168 2015 MiR-26b inhibits hepatocellular carcinoma cell proliferation, migration, and invasion by targeting EphA2.
26177500 2015 EphA2 Is a Potential Player of Malignant Cellular Behavior in Non-Metastatic Renal Cell Carcinoma Cells but Not in Metastatic Renal Cell Carcinoma Cells.
More...