Property Summary

Ligand Count 18
NCBI Gene PubMed Count 234
PubMed Score 874.64
PubTator Score 341.83

Knowledge Summary

Patent (192,584)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cataract 297 0.0 4.0
Disease Target Count Z-score Confidence
Pulmonary embolism 55 6.984 3.5
Cancer 2499 4.954 2.5

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma -1.053 3.6e-06
Atopic dermatitis 1.100 1.8e-04
atypical teratoid / rhabdoid tumor 1.100 9.0e-03
Breast cancer -1.600 3.4e-22
chronic rhinosinusitis -1.171 3.7e-02
group 3 medulloblastoma 1.400 3.0e-02
intraductal papillary-mucinous neoplasm ... 2.100 3.6e-03
lung carcinoma -1.200 2.6e-10
nasopharyngeal carcinoma -1.200 1.7e-07
ovarian cancer -1.100 1.5e-04
pancreatic cancer 1.400 2.2e-05
pancreatic ductal adenocarcinoma liver m... 1.795 7.4e-03
psoriasis 1.100 1.5e-06
sarcoidosis -1.100 3.7e-02
spina bifida -1.840 4.8e-02
ulcerative colitis 2.000 2.0e-06

PDB (51)

Gene RIF (192)

AA Sequence

MELQAARACFALLWGCALAAAAAAQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNIMNDMPIYMYSVC      1 - 70
NVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETFNLYYAESDLDYGTNFQKRLFT     71 - 140
KIDTIAPDEITVSSDFEARHVKLNVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYYKKCPELLQGLAH    141 - 210
FPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGF    211 - 280
FKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTP    281 - 350
PQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSG    351 - 420
LVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGF    421 - 490
SVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNLAVIGGVAVGVVLLLVLAGVGFFIHR    491 - 560
RRKNQRARQSPEDVYFSKSEQLKPLKTYVDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKG    561 - 630
MLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGAL    631 - 700
DKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEA    701 - 770
TYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPM    771 - 840
DCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTSGSEGVPFRTVS    841 - 910
EWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPI        911 - 976
//

Text Mined References (248)

PMID Year Title