Property Summary

NCBI Gene PubMed Count 467
PubMed Score 2131.88
PubTator Score 997.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (30)

Disease log2 FC p
diabetes mellitus -1.600 3.6e-02
active ulcerative colitis 1.220 2.9e-02
adrenocortical carcinoma -2.445 5.0e-03
Atopic dermatitis -1.500 2.3e-02
atypical teratoid / rhabdoid tumor 1.700 6.9e-03
autosomal dominant Emery-Dreifuss muscul... 1.903 4.9e-03
Becker muscular dystrophy 1.141 4.8e-02
Breast cancer -1.100 8.9e-03
cystic fibrosis 2.700 5.9e-04
cystic fibrosis and chronic rhinosinusit... -1.335 2.2e-02
Duchenne muscular dystrophy 1.223 4.8e-04
ependymoma 2.500 1.1e-02
gastric carcinoma 2.300 1.3e-03
glioblastoma 2.300 1.3e-02
interstitial cystitis 1.900 3.1e-03
intraductal papillary-mucinous adenoma (... -1.900 3.0e-02
intraductal papillary-mucinous carcinoma... -2.800 2.9e-03
juvenile dermatomyositis 1.182 3.8e-05
limb girdle muscular dystrophy 2A 1.239 1.6e-03
lung adenocarcinoma -2.100 2.1e-08
lung carcinoma -2.400 2.6e-16
malignant mesothelioma -1.700 2.8e-07
nasopharyngeal carcinoma -1.700 1.5e-04
Obesity 1.200 3.3e-02
ovarian cancer -1.400 1.7e-02
pancreatic cancer 2.700 1.1e-04
pituitary cancer -2.100 2.0e-04
primary pancreatic ductal adenocarcinoma 3.145 5.3e-05
psoriasis -1.300 2.9e-04
spina bifida -2.193 3.9e-02

Protein-protein Interaction (8)

Gene RIF (452)

AA Sequence

MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE      1 - 70
RDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMD     71 - 140
VRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACS    141 - 210
KTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR    211 - 280
AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA     281 - 349
//

Text Mined References (468)

PMID Year Title