Property Summary

NCBI Gene PubMed Count 433
Grant Count 516
R01 Count 311
Funding $61,458,640.77
PubMed Score 1870.46
PubTator Score 997.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (61)

Disease Z-score Confidence
Kidney disease 396 5.558 2.8
Systemic scleroderma 66 5.151 2.6
Pulmonary Fibrosis 66 5.095 2.5
Ureteral disease 23 4.509 2.3
Gingival overgrowth 6 4.339 2.2
Cancer 2,346 4.319 2.2
diabetes mellitus 1,663 4.318 2.2
Heart disease 279 3.947 2.0
Glaucoma 134 3.885 1.9
Hypertension 287 3.766 1.9
Liver disease 219 3.542 1.8
Diabetic Retinopathy 53 3.401 1.7
Proliferative vitreoretinopathy 17 3.301 1.7
Adhesions of uterus 4 3.27 1.6
Oral Submucous Fibrosis 18 3.267 1.6
Arthritis 248 3.076 1.5
Atherosclerosis 275 3.059 1.5
Pneumonia 133 3.045 1.5
Adenocarcinoma 115
Aortic valve insufficiency 22
Atopic dermatitis 944
Becker muscular dystrophy 187
Breast cancer 3,094
Congenital diaphragmatic hernia 43
Contact Dermatitis 80
Duchenne muscular dystrophy 602
Female infertility 28
Focal glomerulosclerosis 22
Heart failure 80
Hepatitis B, Chronic 15
Hypertensive disease 193
Liver Cirrhosis 101
Lung Neoplasms 171
Lung diseases 48
Obesity 616
Precursor B-Cell Lymphoblastic Leukemia-... 11 
Prenatal Exposure Delayed Effects 9
Rheumatoid Arthritis 1,160
adrenocortical carcinoma 1,427
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
cystic fibrosis 1,665
ependymoma 2,514
gastric carcinoma 832
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2I 56
lung adenocarcinoma 2,713
lung carcinoma 2,844
malignant mesothelioma 3,162
nasopharyngeal carcinoma 1,056
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
spina bifida 1,064
ulcerative colitis 2,087

Expression

Synonym

Accession P29279 E1P578 Q6LCY0 Q96A79 Q96QX2 Q9UDL6
Symbols CCN2
NOV2
HCS24
IGFBP8

Gene

PANTHER Protein Class (2)

Gene RIF (418)

PMID Text
26909983 The gradual increase of CTGF and TGF-beta1 expression levels in liver tissue is associated with liver fibrosis. Early expression of CTGF and TGF-beta1 in biliary epithelial cells may be involved in the pathogenesis of congenital biliary atresia.
26719893 TGF-beta and CCN2 play an important role in IUA formation.
26707502 small interfering RNAmediated silencing of CTGF promoted cell death and suppressed osteosarcoma cell migration and invasion.
26577677 Findings suggest that GDF8 and CTGF may play critical roles in the regulation of proliferative events in human granulosa cells.
26575166 In high-grade serous ovarian tumors the highest level of tumor stromal CTGF expression was correlated with the poorest prognosis. Identify CTGF as a promoter of peritoneal adhesion, likely to mediate metastasis, and a potential therapeutic target in high-grade serous ovarian cancer.
26498181 Studies indicate that the CYR61 CTGF NOV matricellular proteins (CCN family of proteins) comprises the members CCN1, CCN2, CCN3, CCN4, CCN5 and CCN6 and have been identified in various types of cancer.
26421309 renoprotective therapeutic agents can specifically abolish CCN2 expression in diabetic nephropathy; CCN2 plays a pivotal role in disease progression [review]
26318291 CTGF was able to induce tumor cell epithelial-mesenchymal transition (EMT), and promote stroma deposition of collagen I fibers to stimulate tumor growth and metastasis.
26218313 Report opposing effects of CCN2 and CCN5 on fibroblast proliferation and transdifferentiation induced by TGF-beta.
26192087 Studied how rapamycin affects CCN2 expression and migration of lung fibroblasts in vitro; PI3K and inhibitors were used to determine rapamycin's mechanism of action.
More...

AA Sequence

MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTE      1 - 70
RDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMD     71 - 140
VRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACS    141 - 210
KTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYR    211 - 280
AKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA     281 - 349
//

Text Mined References (434)

PMID Year Title
26909983 2016 Expression of transforming growth factor-?1 and connective tissue growth factor in congenital biliary atresia and neonatal hepatitis liver tissue.
26719893 2015 The Overexpression of TGF-? and CCN2 in Intrauterine Adhesions Involves the NF-?B Signaling Pathway.
26707502 2016 Downregulation of connective tissue growth factor reduces migration and invasiveness of osteosarcoma cells.
26577677 2016 Growth differentiation factor 8 suppresses cell proliferation by up-regulating CTGF expression in human granulosa cells.
26575166 2015 Connective tissue growth factor as a novel therapeutic target in high grade serous ovarian cancer.
26498181 2015 Emerging role of CCN family proteins in tumorigenesis and cancer metastasis (Review).
26421309 2015 Potential Renoprotective Agents through Inhibiting CTGF/CCN2 in Diabetic Nephropathy.
26318291 2015 Epithelial derived CTGF promotes breast tumor progression via inducing EMT and collagen I fibers deposition.
26218313 2015 CCN2 and CCN5 exerts opposing effect on fibroblast proliferation and transdifferentiation induced by TGF-?.
26192087 2015 Rapamycin increases CCN2 expression of lung fibroblasts via phosphoinositide 3-kinase.
More...