Property Summary

NCBI Gene PubMed Count 102
Grant Count 33
R01 Count 15
Funding $5,601,669.47
PubMed Score 99.17
PubTator Score 52.58

Knowledge Summary

Patent (3,689)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 0.007
medulloblastoma -2.300 0.000
medulloblastoma, large-cell -1.700 0.001
tuberculosis -1.800 0.000
non-small cell lung cancer 1.208 0.000
pancreatic cancer 1.300 0.000

Gene RIF (86)

PMID Text
26748211 A2B receptor activation is critically required for the stimulatory effect of adenosine on IL-10 production and suppression of nitric oxide release.
26478435 ADORA2B is a target gene of miR-128b.MiR-128b represses cell proliferation, migration and invasion and promotes apoptosis by targeting ADORA2B in gastric cancer.
26228921 Data show that ADORA2B mRNA and protein were significantly up-regulated in oral squamous cell carcinoma (OSCC) and that ADORA2B controls cellular proliferation via HIF-1alpha activation, suggesting it may be a key regulator of tumoral progression in OSCCs.
25966978 the A2B AR activation-driven angiogenesis via cAMP-PKA-CREB mediates VEGF production and PI3K/AKT-dependent upregulation of eNOS in HMEC-1
25765819 our data suggest that adenosine A2b signaling represses CIITA transcription in VSMCs by manipulating the interaction between STAT1 and the epigenetic machinery.
25629231 The rs7208480 of ADORA2B as well as the haplotypes were not found to be associated with chronic heart failure susceptibility.
25587035 the A2B adenosine receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitro
25429616 Stimulation of A1AR and A2BAR had a prominent anti-proliferative/pro-apoptotic effect on the glioblastoma stem cells.
25087184 Data indicate adenosine receptor ADORA2B as the specific receptor and signalling pathway for the metabolite 5'-methylthioadenosine (MTA).
25002363 A2B receptor activation blunts trophoblast migration possibly as a result of reduced activation of the MAPK signaling pathway and lower proMMP-2 levels.
More...

AA Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLG      1 - 70
FCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTP     71 - 140
FLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVAC    141 - 210
RQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSH    211 - 280
ANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL                      281 - 332
//

Text Mined References (102)

PMID Year Title
26748211 2016 Up regulation of A2B adenosine receptor on monocytes are crucially required for immune pathogenicity in Indian patients exposed to Leishmania donovani.
26478435 2015 MicroRNA-128b suppresses tumor growth and promotes apoptosis by targeting A2bR in gastric cancer.
26228921 2015 Adenosine A2b receptor promotes progression of human oral cancer.
25966978 2015 Adenosine A2B receptor stimulates angiogenesis by inducing VEGF and eNOS in human microvascular endothelial cells.
25765819 2015 A2b adenosine signaling represses CIITA transcription via an epigenetic mechanism in vascular smooth muscle cells.
25629231 2015 The association of ADORA2A and ADORA2B polymorphisms with the risk and severity of chronic heart failure: a case-control study of a northern Chinese population.
25587035 2015 Elevated adenosine signaling via adenosine A2B receptor induces normal and sickle erythrocyte sphingosine kinase 1 activity.
25429616 2014 Modulation of A1 and A2B adenosine receptor activity: a new strategy to sensitise glioblastoma stem cells to chemotherapy.
25087184 2014 The metabolite 5'-methylthioadenosine signals through the adenosine receptor A2B in melanoma.
25002363 2014 Activation of adenosine A2B receptor impairs properties of trophoblast cells and involves mitogen-activated protein (MAP) kinase signaling.
More...