Property Summary

NCBI Gene PubMed Count 29
Grant Count 10
R01 Count 2
Funding $1,286,366.8
PubMed Score 195.68
PubTator Score 159.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.176 0.015
hereditary spastic paraplegia -1.293 0.001
intraductal papillary-mucinous neoplasm ... 1.900 0.009
ovarian cancer -2.000 0.000

Gene RIF (4)

PMID Text
23027737 Comparison of MmIMPase 1 and HsIMPase 1 revealed a core r.m.s. deviation of 0.516 A
20153384 The current study did not support a substantial role of the upregulation of IMPase in bipolar disorder, although the lithium-insensitivity trait seen in IMPA2 transgenic mice might represent some aspect relevant to the inositol depletion hypothesis.
17068342 IMPA2 has a separate function in vivo from that of IMPA1
14699425 No association between polymorphisms and bipolar disorder

AA Sequence

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE      1 - 70
ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF     71 - 140
CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA    141 - 210
YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED       211 - 277
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23027737 2012 Cloning, expression, purification, crystallization and X-ray analysis of inositol monophosphatase from Mus musculus and Homo sapiens.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20153384 2010 Behavioral analyses of transgenic mice harboring bipolar disorder candidate genes, IMPA1 and IMPA2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
More...