Property Summary

Ligand Count 10
NCBI Gene PubMed Count 58
PubMed Score 216.36
PubTator Score 90.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.685 3.5e-02
colon cancer -2.000 3.0e-02
Down syndrome 1.100 9.0e-03
facioscapulohumeral dystrophy -1.700 2.4e-02
fibroadenoma 1.300 2.3e-04
gastric cancer 1.100 2.0e-03
group 3 medulloblastoma -1.600 3.7e-02
intraductal papillary-mucinous neoplasm ... 1.900 7.3e-03
lung cancer 1.100 1.2e-02
malignant mesothelioma 3.900 7.1e-09
mucosa-associated lymphoid tissue lympho... 1.002 2.3e-02
osteosarcoma -1.245 4.6e-03
ovarian cancer 1.100 4.2e-05
pancreatic cancer 1.400 4.8e-04
pancreatic carcinoma 1.400 4.8e-04
pancreatic ductal adenocarcinoma liver m... -2.971 8.1e-04
pituitary cancer -2.200 5.5e-06
posterior fossa group A ependymoma -1.100 6.7e-05
psoriasis 1.100 3.0e-10
subependymal giant cell astrocytoma -2.087 5.0e-02
ulcerative colitis -1.200 2.1e-03

Gene RIF (38)

AA Sequence

MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAACSAPPPRPVY      1 - 70
TNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQ     71 - 140
QEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIER    141 - 210
NHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLD    211 - 280
GDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR    281 - 350
EGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS    351 - 420
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEA    421 - 490
KKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYL    491 - 560
VSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILY    561 - 630
GTAEHPYHTFSAHQSRSRMLELSAPELEPPKAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECG    631 - 700
DKGCDGPNADQCLNCVHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRG    701 - 770
FYHHQEMNTCVTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS    771 - 840
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAG    841 - 910
SSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG               911 - 969
//

Text Mined References (58)

PMID Year Title