Property Summary

NCBI Gene PubMed Count 54
PubMed Score 212.08
PubTator Score 90.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 7.09710702404567E-10
malignant mesothelioma 3163 7.14948647809537E-9
pituitary cancer 1972 5.51439517629642E-6
ovarian cancer 8492 4.19184445390486E-5
posterior fossa group A ependymoma 1511 6.74338682821559E-5
fibroadenoma 557 2.29417432564881E-4
pancreatic cancer 2300 4.84408627327603E-4
pancreatic carcinoma 567 4.84408627327613E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 8.13901536602787E-4
lung cancer 4473 0.00159829584377992
group 4 medulloblastoma 1875 0.00178492697917557
gastric cancer 436 0.00199509869306444
ulcerative colitis 2087 0.00213130321452381
osteosarcoma 7933 0.00464749465677677
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00734311125199907
Down syndrome 548 0.00895993524610586
mucosa-associated lymphoid tissue lymphoma 480 0.022648636783937
facioscapulohumeral dystrophy 286 0.0241541121616152
colon cancer 1475 0.0296613900464839
adrenocortical carcinoma 1427 0.0352148870823002
subependymal giant cell astrocytoma 2287 0.049945351378786
Disease Target Count Z-score Confidence
Learning disability 20 0.0 2.0
Disease Target Count Z-score Confidence
Malaria 140 3.902 2.0
Dyslexia 36 3.11 1.6

Expression

Synonym

Gene

PANTHER Protein Class (3)

Gene RIF (33)

PMID Text
26604689 PACE4 regulates apoptosis in human prostate cancer cells via endoplasmic reticulum stress and mitochondrial signaling pathways
26283733 Vpr processing by soluble PCSK6 (PACE4) DOES NOT involve PAR1
26259032 identified a PCSK6 mutation that impaired corin activation activity in a hypertensive patient
26114115 PACE4-knockdown associated growth deficiencies were established on the knockdown HepG2, Huh7, and HT1080 cells as well as the antiproliferative effects of the multi-Leu peptide supporting the growth capabilities of PACE4 in cancer cells.
25433529 PCSK6 is upregulated in the synovial tissues of patients with rheumatoid arthritis and has a genetic effect on the risk of rheumatoid arthritis. Inhibition of PCSK6 may play a protective role in the development of rheumatoid arthritis.
24913567 miR-124 exhibits antiproliferative and antiaggressive effects on prostate cancer cells through PACE4 pathway.
24860148 PCSK6 regulated by LH inhibits the apoptosis of human granulosa cells via activin A and TGFbeta2.
23908247 PCSK6 was detected at increased levels in the fibrous cap of symptomatic carotid plaques, possibly associated with key processes in plaque rupture such as inflammation and extracellular matrix remodeling.
23226097 PACE4 has a distinct role in maintaining proliferation and tumor progression in prostate cancer.
22440827 A variant in PCSK6 is strongly associated with protection against pain in knee osteoarthritis.
More...

AA Sequence

MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAACSAPPPRPVY      1 - 70
TNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQ     71 - 140
QEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIER    141 - 210
NHPDLAPNYDSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLD    211 - 280
GDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGR    281 - 350
EGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS    351 - 420
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGLVDAEALVVEA    421 - 490
KKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLEHVVVRTSISHPRRGDLQIYL    491 - 560
VSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILY    561 - 630
GTAEHPYHTFSAHQSRSRMLELSAPELEPPKAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECG    631 - 700
DKGCDGPNADQCLNCVHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRG    701 - 770
FYHHQEMNTCVTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS    771 - 840
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAG    841 - 910
SSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG               911 - 969
//

Text Mined References (54)

PMID Year Title
26908617 2016 The handedness-associated PCSK6 locus spans an intronic promoter regulating novel transcripts.
26604689 2015 PACE4 regulates apoptosis in human prostate cancer cells via endoplasmic reticulum stress and mitochondrial signaling pathways.
26259032 2015 PCSK6-mediated corin activation is essential for normal blood pressure.
26114115 2015 Multi-Leu PACE4 Inhibitor Retention within Cells Is PACE4 Dependent and a Prerequisite for Antiproliferative Activity.
25433529 2015 Inhibition of PCSK6 may play a protective role in the development of rheumatoid arthritis.
24913567 2014 miR-124 exhibits antiproliferative and antiaggressive effects on prostate cancer cells through PACE4 pathway.
24860148 2014 PCSK6 regulated by LH inhibits the apoptosis of human granulosa cells via activin A and TGF?2.
24068947 2013 Common variants in left/right asymmetry genes and pathways are associated with relative hand skill.
23908247 2013 Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis.
23775089 2013 The multifaceted proprotein convertases: their unique, redundant, complementary, and opposite functions.
More...