Property Summary

NCBI Gene PubMed Count 45
PubMed Score 3.01
PubTator Score 13.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
TRICHOTHIODYSTROPHY 6, NONPHOTOSENSITIVE 1 0.0 0.0
Disease Target Count
Trichothiodystrophy Syndromes 6
Disease Target Count P-value
ovarian cancer 8520 1.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Werner syndrome 29 3.711 1.9
Tendinitis 14 3.377 1.7
Disease Target Count
Photosensitive trichothiodystrophy 30

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.400 1.7e-03

 MGI Phenotype (1)

Gene RIF (13)

AA Sequence

MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGS      1 - 70
SGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFK     71 - 140
PKYNVRDKKALLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQF    141 - 210
SVDEEFQKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGV    211 - 280
LKDYSDITSSK                                                               281 - 291
//

Text Mined References (49)

PMID Year Title