Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.33
PubTator Score 15.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.000
malignant mesothelioma 1.300 0.000
lung cancer 1.200 0.005
Breast cancer 2.700 0.027
ovarian cancer 1.200 0.002

Synonym

Accession P29083 Q16103
Symbols FE
TF2E1
TFIIE-A

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IYA   5IYB   5IYC   5IYD   1VD4   2JTX   2RNQ   2RNR  

Gene RIF (12)

PMID Text
25492609 Association of the winged helix motif of the TFIIEalpha subunit of TFIIE with either the TFIIEbeta subunit or TFIIB distinguishes its functions in transcription.
22404213 Knockdown of general transcription factor IIE, polypeptide 1, alpha 56kDa (GTF2E1; TFIIE1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
21489275 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
18950845 Observational study of gene-disease association. (HuGE Navigator)
18354501 The specific binding of the C-terminal acidic domain (AC-D) of the human TFIIEalpha subunit to the pleckstrin homology domain (PH-D) of the human TFIIH p62 subunit is demonstrated.
18160537 interplay between TFIIEalpha and the tumor suppressor protein p53 in regulating transcriptional activation that may be modulated by the phosphorylation status of p53
16547462 TFIIE is an alpha/beta heterodimer in solution. A model for the quaternary architecture of the complex is proposed that provides a structural framework to discuss the function of TFIIE in the context of RNA polymerase II transcription initiation.
15385556 structural integrity of the zinc finger domain is essential for the TFIIE function
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
9054383 HIV-1 Tat interacts with the RNA polymerase II holoenzyme and transcription preinitiation complexes, which include TFIIE, during Tat-mediated transactivation of the HIV-1 LTR
More...

AA Sequence

MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLELLKFDRKQLRSVLNNLKGDK      1 - 70
FIKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLE     71 - 140
ANQLFDPMTGTFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLAYEILEPEPTE    141 - 210
IPALKQSKDHAATTAGAASLAGGHHREAWATKGPSYEDLYTQNVVINMDDQEDLHRASLEGKSAKERPIW    211 - 280
LRESTVQGAYGSEDMKEGGIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTAAN    281 - 350
GSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMVAGRPFSYSEVSQRPELVAQMTP    351 - 420
EEKEAYIAMGQRMFEDLFE                                                       421 - 439
//

Text Mined References (48)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
25492609 2015 Association of the winged helix motif of the TFIIE? subunit of TFIIE with either the TFIIE? subunit or TFIIB distinguishes its functions in transcription.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19106100 2009 MCAF1/AM is involved in Sp1-mediated maintenance of cancer-associated telomerase activity.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...