Property Summary

NCBI Gene PubMed Count 67
PubMed Score 88.29
PubTator Score 109.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.58758530164906E-101
non-small cell lung cancer 2798 6.74924553370439E-17
posterior fossa group A ependymoma 1511 2.31301347367417E-11
colon cancer 1475 7.13059400067363E-11
malignant mesothelioma 3163 2.6483420570547E-6
lung adenocarcinoma 2714 5.16340348688483E-5
ulcerative colitis 2087 5.90039180777301E-5
tuberculosis and treatment for 3 months 327 9.41449740351893E-5
ovarian cancer 8492 9.96926420491313E-5
Atopic dermatitis 944 1.00873131461493E-4
atypical teratoid / rhabdoid tumor 4369 1.65327660878555E-4
glioblastoma 5572 3.44983875808895E-4
pancreatic cancer 2300 7.87427529273978E-4
adult high grade glioma 2148 0.00364082210204903
ductal carcinoma in situ 1745 0.00561488064890629
Breast cancer 3099 0.00701521990972575
subependymal giant cell astrocytoma 2287 0.0154336327395894
nasopharyngeal carcinoma 1056 0.0214511833094815
medulloblastoma, large-cell 6234 0.0231083157807496
esophageal adenocarcinoma 737 0.0316442765670263
spina bifida 1064 0.0491488298219047
Disease Target Count Z-score Confidence
Cancer 2346 3.946 2.0
Syringoma 10 3.377 1.7
Hidrocystoma 4 3.005 1.5

Expression

  Differential Expression (21)

Synonym

Accession P29034 O00266 Q3KRB9 Q5RHS8 Q9BU83
Symbols CAN19
S100L

Gene

PDB

2RGI   4DUQ  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

Gene RIF (44)

PMID Text
25999659 Data show higher expression level of S100A2 in high-invasive cholangiocarcinoma Cell Line suggesting it as potential marker of tumor progression and novel therapeutic target.
25874882 Our investigation complements the current understanding of laryngeal cancer progression. Furthermore, this study supports the concept that enhanced expression of S100A2 may be a promising strategy in developing novel cancer therapeutic drugs.
25591983 The potential of cytoplasmic S100A2 overexpression as a predictor of recurrence risk in oral squamous cell carcinoma patients.
24556685 These data demonstrate the importance of S100A2 downstream of the BRCA1/DeltaNp63 signalling axis in modulating transcriptional responses and enforcing growth control mechanisms through destabilisation of mutant p53.
24318973 loss of S100A2 expression contributes to Ggastric cancer development and progression.
23996929 S100A2 protumorigenic actions and its involvement in TGF-beta-mediated cancer cell invasion and epithelial-mesenchymal transition.
23726265 Data indicate that S100A2 expression predicts longer disease-free survival (DFS) and overall survival (OS) in patients treated with adjuvant therapy and should be evaluated as a predictive biomarker.
23621473 Expression of S100A2 in cholangiocarcinoma cells significantly correlated with the histological grade, lymph node metastasis, clinical stage, and a poor survival rate of the patients. Thus it is a strong tumor marker for the cancer.
23344957 Data indicate S100A2 and S100P proteins as novel Ca2+-dependent regulators of the CHIP-proteasome pathway.
23337980 In conclusion, data from the present study demonstrated that loss of S100A2 expression contributes to gastric cancer development and progression
More...

AA Sequence

MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQ      1 - 70
VDFQEYAVFLALITVMCNDFFQGCPDRP                                               71 - 98
//

Text Mined References (70)

PMID Year Title
25999659 2015 Comparative Proteomic Analysis of Human Cholangiocarcinoma Cell Lines: S100A2 as a Potential Candidate Protein Inducer of Invasion.
25874882 2015 iTRAQ-based quantitative proteomic analysis on S100 calcium binding protein A2 in metastasis of laryngeal cancer.
25591983 2015 Prognostic significance of cytoplasmic S100A2 overexpression in oral cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
24556685 2014 S100A2 is a BRCA1/p63 coregulated tumour suppressor gene with roles in the regulation of mutant p53 stability.
24318973 2014 Clinical significance of S100A2 expression in gastric cancer.
23996929 2014 Protumorigenic actions of S100A2 involve regulation of PI3/Akt signaling and functional interaction with Smad3.
23726265 2013 S100A2 is a predictive biomarker of adjuvant therapy benefit in pancreatic adenocarcinoma.
23621473 2013 Clinicopathological significance of S100 protein expression in cholangiocarcinoma.
23344957 2013 Ca2+/S100 proteins act as upstream regulators of the chaperone-associated ubiquitin ligase CHIP (C terminus of Hsc70-interacting protein).
More...