Property Summary

NCBI Gene PubMed Count 57
PubMed Score 608.95
PubTator Score 735.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 2.100 2.7e-02
Chronic Lymphocytic Leukemia -2.159 3.2e-07
cutaneous lupus erythematosus -2.600 2.4e-03
lung cancer -3.500 4.2e-06
lung carcinoma -1.300 2.7e-12
nasopharyngeal carcinoma -1.300 5.5e-04
non-small cell lung cancer -1.212 4.9e-17
osteosarcoma -1.668 2.6e-04
tuberculosis 1.900 9.6e-07

Gene RIF (37)

AA Sequence

MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHN      1 - 70
WSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLD     71 - 140
LLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWL    141 - 210
SSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSC    211 - 280
RVRHSSLGGQDIILYWGHHFSMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL                     281 - 333
//

Text Mined References (58)

PMID Year Title