Property Summary

NCBI Gene PubMed Count 53
Grant Count 101
R01 Count 70
Funding $13,003,561.72
PubMed Score 563.36
PubTator Score 735.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Chronic Lymphocytic Leukemia -2.159 0.000
cutaneous lupus erythematosus -2.600 0.002
osteosarcoma -1.668 0.000
tuberculosis and treatment for 3 months 2.300 0.000
non-small cell lung cancer -1.212 0.000
lung cancer -3.500 0.000
nasopharyngeal carcinoma -1.300 0.001
lung carcinoma -1.300 0.000
acute myeloid leukemia 2.100 0.027

Synonym

Accession P29017 Q5TDJ7 Q6IAS4 Q9UMM0 Q9UN96
Symbols R7
CD1
CD1A
BDCA1

Gene

PDB

3OV6   4ONO   5C9J  

Gene RIF (33)

PMID Text
26884207 human CD1c adopts different conformations dependent on ligand occupancy of its groove, with CE and ASG stabilizing CD1c conformations that provide a footprint for binding of CD1c self-reactive T-cell receptors
25784146 There was a significant increase of blood CD1c(+) myeloid dendritic cells in autoimmune uveitis patients. The mature phenotype and function of CD1c(+) mDC1 were regulated by TNFalpha via a p38 MAPK-dependent pathway.
24935257 mLPA-specific T cells efficiently kill CD1c(+) acute leukemia cells, poorly recognize nontransformed CD1c-expressing cells, and protect immunodeficient mice against CD1c(+) human leukemia cells.
24918929 hMPV-infected BDCA-1(+) and BDCA-3(+) mDCs induced expansion of Th17 cells, in response to RSV, BDCA-1(+) mDCs induced expansion of Th1 cells and BDCA-3(+) mDCs induced expansion of Th2 cells and Tregs
24573986 decidual CD1c(+) dendritic cells with Toxoplasma gondii infection have enhanced cytotoxicity of decidual natural killer cells
24556395 [review] Humans express both Group 1 (CD1a, CD1b and CD1c) and Group 2 (CD1d) CD1 molecules with nonredundant functions in response to the presentation of endogenous lipids.
24049150 Activated dendritic cell subsets expressing CD141/CLEA9A/CD1c, likely recruited into the tubulointerstitium, are positioned to play a role in the development of fibrosis and, thus, progression to chronic kidney disease.
23829893 RSV infection induces a distinct pattern of costimulatory molecule expression and cytokine production by BDCA-1(+) and BDCA-3(+) mDCs, and impairs their ability to stimulate T cell proliferation.
23766460 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 for isoforms CD1b through CD1e, our simulations show the near-complete collapse of the hydrophobic cavities in the absence of the antigen. This event results from the spontaneous closure of the binding domain entrance, flanked by two alpha-helices.
More...

AA Sequence

MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHN      1 - 70
WSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLD     71 - 140
LLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWL    141 - 210
SSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSC    211 - 280
RVRHSSLGGQDIILYWGHHFSMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL                     281 - 333
//

Text Mined References (54)

PMID Year Title
26884207 2016 Cholesteryl esters stabilize human CD1c conformations for recognition by self-reactive T cells.
25784146 2015 Increased CD1c+ mDC1 with mature phenotype regulated by TNF?-p38 MAPK in autoimmune ocular inflammatory disease.
24935257 2014 A novel self-lipid antigen targets human T cells against CD1c(+) leukemias.
24918929 2014 Paramyxovirus infection regulates T cell responses by BDCA-1+ and BDCA-3+ myeloid dendritic cells.
24573986 2014 Toxoplasma gondii infection of decidual CD1c(+) dendritic cells enhances cytotoxicity of decidual natural killer cells.
24556395 2014 Lipid presentation by human CD1 molecules and the diverse T cell populations that respond to them.
24049150 2013 Increased tubulointerstitial recruitment of human CD141(hi) CLEC9A(+) and CD1c(+) myeloid dendritic cell subsets in renal fibrosis and chronic kidney disease.
23829893 2013 Differential response of BDCA-1+ and BDCA-3+ myeloid dendritic cells to respiratory syncytial virus infection.
23766460 2013 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 2013 Dynamics of the antigen-binding grooves in CD1 proteins: reversible hydrophobic collapse in the lipid-free state.
More...