Property Summary

Ligand Count 1
NCBI Gene PubMed Count 196
PubMed Score 2817.49
PubTator Score 2042.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
fibroadenoma -1.200 3.7e-03

Gene RIF (177)

AA Sequence

MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCE      1 - 70
PDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFP     71 - 140
GTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTR    141 - 210
APDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRT    211 - 280
CECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSP    281 - 350
TQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL    351 - 420
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASP    421 - 490
AGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHY    491 - 560
PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK                                       561 - 595
//

Text Mined References (202)

PMID Year Title