Property Summary

NCBI Gene PubMed Count 183
PubMed Score 2680.58
PubTator Score 2042.15

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
fibroadenoma -1.200 0.004


Accession P28908 B1AN79 B9EGD9 D3YTD8 Q6P4D9
Symbols CD30




  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

Gene RIF (163)

26884853 CD30 may be useful as a prognostic marker in rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) treated DLBCLs, indicating favorable outcomes in a Chinese population.
26709646 this review is focused on the role of CD30 receptor and p53 as novel targets for therapy in ALK+ ALCL, and also provides an update on their potential involvement in ALK+ ALCL pathogenesis
26574847 Most angioimmunoblastic T-cell lymphoma and peripheral T-cell lymphoma-not otherwise specified express variable levels of CD30.
26371781 Intralymphatic variant of ALCL and LyP may be explained, at least in part, by a particular lymphotropism of the neoplastic cells of cutaneous CD30 lymphoproliferative disorders.
26273636 Our results demonstrated significantly elevated sCD30 levels in AS patients compared to healthy controls (HCs) with mean values of 32.0 +/- 12.2 and 24.9 +/- 8.0 ng/mL, (P(**) = 0.007), suggesting a p role of sCD30 in the pathogenesis of AS.
26261484 Upregulated expression of CD30 is commonly found in sclerosing angiomatoid nodular transformation of the spleen.
25840583 Data indicate that CD30 antigen downregulation and P-Glycoprotein (MDR1) upregulation are associated with drug resistance to brentuximab vedotin.
25698648 These results show that high sCD30 levels are independent predictors of graft dysfunction
25568342 Single threonine residue at position 61 in CD30v that is critical for TRAF2 interaction, NFkappaB activation, and downstream CD30-NFkappaB-dependent phenotypes in hESCs was identified.
25567136 Elevated serum sCD30 is associated with increased risk of non-Hodgkin lymphoma.

AA Sequence

PEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK                                       561 - 595

Text Mined References (189)

PMID Year Title
26884853 2015 Prevalence and clinicopathologic features of CD30-positive de novo diffuse large B-cell lymphoma in Chinese patients: a retrospective study of 232 cases.
26709646 2016 The emerging role of CD30 and p53 as novel targets for therapy in anaplastic large cell lymphoma.
26574847 2016 CD30 Expression by B and T Cells: A Frequent Finding in Angioimmunoblastic T-Cell Lymphoma and Peripheral T-Cell Lymphoma-Not Otherwise Specified.
26371781 2015 Intralymphatic Spread Is a Common Finding in Cutaneous CD30+ Lymphoproliferative Disorders.
26273636 2015 Elevated Serum Levels of Soluble CD30 in Ankylosing Spondylitis Patients and Its Association with Disease Severity-Related Parameters.
26261484 2015 Upregulated expression of CD30 protein in sclerosing angiomatoid nodular transformation (SANT): studies of additional 4 cases and analyses of 6 cases previously published cases.
25840583 2015 CD30 Downregulation, MMAE Resistance, and MDR1 Upregulation Are All Associated with Resistance to Brentuximab Vedotin.
25698648 2015 Post-transplant soluble CD30 levels are associated with early subclinical rejection in kidney transplantation.
25568342 2015 TRAF2 recruitment via T61 in CD30 drives NF?B activation and enhances hESC survival and proliferation.
25567136 2015 Elevated serum sCD23 and sCD30 up to two decades prior to diagnosis associated with increased risk of non-Hodgkin lymphoma.