Property Summary

Ligand Count 60
NCBI Gene PubMed Count 213
PubMed Score 2663.10
PubTator Score 1601.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.400 7.3e-03
Chronic Lymphocytic Leukemia -1.077 5.1e-03
cutaneous lupus erythematosus 2.700 1.2e-03
Duchenne muscular dystrophy -1.029 5.1e-07
interstitial cystitis 3.200 1.4e-03
lung cancer -1.200 1.7e-03
lung carcinoma -3.500 1.1e-22
osteosarcoma -1.997 1.6e-07
periodontitis 1.600 1.4e-25
primary Sjogren syndrome 1.300 2.5e-04
psoriasis 2.200 8.6e-93
ulcerative colitis 2.300 6.8e-05

PDB (41)

Gene RIF (203)

AA Sequence

MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFPETVLARCVKY      1 - 70
TEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQR     71 - 140
DMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNG    141 - 210
SRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR    211 - 280
PDKFLQCVKNPEDSSCTSEI                                                      281 - 300
//

Text Mined References (218)

PMID Year Title