Property Summary

NCBI Gene PubMed Count 206
Grant Count 327
R01 Count 194
Funding $47,197,355.48
PubMed Score 2528.25
PubTator Score 1601.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.077 0.005
astrocytic glioma 1.400 0.007
cutaneous lupus erythematosus 2.700 0.001
osteosarcoma -1.997 0.000
periodontitis 1.600 0.000
Duchenne muscular dystrophy -1.029 0.000
lung cancer -2.800 0.000
interstitial cystitis 3.500 0.000
primary Sjogren syndrome 1.300 0.000
lung carcinoma -3.500 0.000
ulcerative colitis 2.300 0.000
psoriasis 2.200 0.000

Synonym

Accession P28907 O00121 O00122 Q96HY4
Symbols ADPRC1
ADPRC 1

Gene

PANTHER Protein Class (2)

PDB

1YH3   1ZVM   2EF1   2HCT   2I65   2I66   2I67   2O3Q   2O3R   2O3S   2O3T   2O3U   2PGJ   2PGL   3DZF   3DZG   3DZH   3DZI   3DZJ   3DZK   3F6Y   3I9M   3I9N   3OFS   3RAJ   3ROK   3ROM   3ROP   3ROQ   3U4H   3U4I   4CMH   4F45   4F46   4OGW   4TMF   4XJS   4XJT   5F1K   5F1O   5F21  

Gene RIF (196)

PMID Text
27064238 Results may imply that CD38 expression either reflects or participates in pathogenic mechanisms of HIV disease independently of cell cycling.
26852663 The frequencies of CD19+CD24hiCD38hi B-regulatory lymphocyte were significantly increased in children with beta-thalassemia.
26470437 alterations in content of soluble molecules CD38 are associated with characteristics of tumor process that indicates at their monitoring significance under malignant neoplasms of uterus
26407101 soluble CD38 (sCD38) in seminal plasma increases the capacitation of sperm via specific interactions between sCD38 and the CD31 on the sperm.
26371313 Genetic variation in CD38 and breastfeeding experience interact to impact infants' attention to social eye cues.
26365593 the expression of CD38+ on both CD4+, CD8+T lymphocytes from peripheral blood and CSF discriminated between viremic and non-viremic patients
26329660 Primary human melanoma cell lines suppress in vitro T cell proliferation through an adenosinergic pathway in which CD38 and CD73 play a prominent role.
26306999 The data suggest that ZO-1, along with CD38 and Zap-70, plays a role in cell cycle regulation in chronic B cell leukemia, and may be used as a prognostic marker in the disease monitoring.
26294209 CD38 is expressed on human MDSC-like cell population that is expanded in the peripheral blood of advanced-stage cancer patients.
26170397 Hairy-cell leukemia patients that were CD38-positive had a shorter mean time to salvage therapy than CD38-negative ones. CD38 expression in HCL drives poor prognosis by promoting survival and heterotypic adhesion.
More...

AA Sequence

MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQWSGPGTTKRFPETVLARCVKY      1 - 70
TEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQR     71 - 140
DMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLNG    141 - 210
SRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYR    211 - 280
PDKFLQCVKNPEDSSCTSEI                                                      281 - 300
//

Text Mined References (211)

PMID Year Title
27064238 2016 CD38 Expression in a Subset of Memory T Cells Is Independent of Cell Cycling as a Correlate of HIV Disease Progression.
26852663 2016 Regulatory B cells (CD19(+)CD38(hi)CD24(hi)) in alloimmunized and non-alloimmunized children with ?-thalassemia major.
26470437 2015 [THE SERUM LEVEL OF TOTAL AND OLIGOMERIC FRACTIONS OF SOLUBLE MOLECULES CD38 UNDER MALIGNANT TUMORS OF CERVIX AND UTERINE BODY].
26407101 2015 Seminal CD38 Enhances Human Sperm Capacitation through Its Interaction with CD31.
26371313 2015 Genetic variation in CD38 and breastfeeding experience interact to impact infants' attention to social eye cues.
26365593 2015 Increased CD38 expression on T lymphocytes as a marker of HIV dissemination into the central nervous system.
26329660 2015 A non-canonical adenosinergic pathway led by CD38 in human melanoma cells induces suppression of T cell proliferation.
26306999 2016 ZO-1 expression shows prognostic value in chronic B cell leukemia.
26294209 2015 CD38-Expressing Myeloid-Derived Suppressor Cells Promote Tumor Growth in a Murine Model of Esophageal Cancer.
26170397 2015 CD38 in Hairy Cell Leukemia Is a Marker of Poor Prognosis and a New Target for Therapy.
More...