Property Summary

NCBI Gene PubMed Count 302
PubMed Score 13698.42
PubTator Score 10665.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cell Transformation, Neoplastic 97 0.0 0.0
Disease Target Count Z-score Confidence
Heart disease 306 3.514 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.100 4.4e-03
ductal carcinoma in situ -1.500 1.1e-03
glioblastoma 1.100 2.9e-05
invasive ductal carcinoma -1.401 1.8e-03
lung adenocarcinoma -1.200 5.3e-08
lung cancer -1.300 5.4e-04
non-small cell lung cancer -1.314 6.1e-17
psoriasis -1.400 5.6e-07

Gene RIF (269)

AA Sequence

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST      1 - 70
SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP     71 - 140
GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL    141 - 210
ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV    211 - 280
ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ    281 - 350
GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL                                       351 - 385
//

Text Mined References (302)

PMID Year Title