Property Summary

NCBI Gene PubMed Count 210
Grant Count 46
R01 Count 19
Funding $3,352,031.43
PubMed Score 850.27
PubTator Score 309.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Obesity 1.100 0.033
malignant mesothelioma -8.000 0.000
astrocytic glioma -1.600 0.021
ependymoma -1.700 0.032
psoriasis -2.800 0.000
osteosarcoma -1.490 0.003
Atopic dermatitis -3.400 0.000
adrenocortical adenoma -1.172 0.003
adrenocortical carcinoma -1.578 0.000
pancreatic ductal adenocarcinoma liver m... -2.777 0.036
non-small cell lung cancer -1.012 0.000
intraductal papillary-mucinous adenoma (... -1.600 0.018
intraductal papillary-mucinous carcinoma... -2.100 0.007
intraductal papillary-mucinous neoplasm ... -1.900 0.049
lung cancer -1.800 0.002
sarcoidosis 1.700 0.046
breast carcinoma -1.500 0.008
fibroadenoma -2.800 0.013
interstitial cystitis 2.400 0.002
lung adenocarcinoma -2.100 0.000
Pick disease -1.100 0.017
gastric carcinoma 1.800 0.014
ductal carcinoma in situ -1.500 0.012
ulcerative colitis 1.300 0.002
ovarian cancer -1.400 0.000
pituitary cancer -2.500 0.000
pancreatic cancer 1.200 0.010
head and neck cancer and chronic obstruc... 1.500 0.005

Synonym

Accession P28845 B2R9Z1 D3DT89
Symbols HDL
11-DH
HSD11
HSD11B
HSD11L
CORTRD2
SDR26C1
11-beta-HSD1

Gene

PANTHER Protein Class (2)

PDB

1XU7   1XU9   2BEL   2ILT   2IRW   2RBE   3BYZ   3BZU   3CH6   3CZR   3D3E   3D4N   3D5Q   3EY4   3FCO   3FRJ   3H6K   3HFG   3OQ1   3PDJ   3QQP   3TFQ   4BB5   4BB6   4C7J   4C7K   4HFR   4HX5   4IJU   4IJV   4IJW   4K1L   4P38   4YYZ  

Gene RIF (201)

PMID Text
26671915 ins4436A in the HSD11B1 gene is associated with essential hypertension in a Polish population
26528718 the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells.
26452272 we also found a significant difference between AA and AG genotype of rs6688832 and the AG genotype was associated with hyperandrogenism, but no statistical different distribution of polymorphism rs17368528 of H6PD and rs846908 of HSD11B1 were observed
26163245 11beta-HSD1 expressed in polyp-derived epithelial cells may be involved in the anti-inflammatory function of glucocorticoid in the treatment of nasal polyps, which contributes to increased levels of endogenous cortisol.
25989394 Skeletal muscle 11beta-HSD1 is up-regulated with age in women and is associated with reduced grip strength, insulin resistance, and an adverse body composition profile.
25788665 Our work is one of the first comprehensive views of DNA methylation and expression in the placenta for both HSD11B types 1 and 2, linking epigenetic alterations with the regulation of fetal stress and birth weight outcomes.
25751397 Our results indicate that HSD11B1 polymorphisms may contribute toward the development of MetS in psychiatric patients treated with potential weight gain-inducing psychotropic drugs, but do not play a significant role in the general population
25666420 Glucocorticoids and 11beta-hydroxysteroid dehydrogenases: mechanisms for hypertension
25659145 Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11betaHSD1.
25436731 This review describes the body of work performed over the past decade detailing the importance and regulation of HSD11B1 in humans, and its relevance to metabolic disease. [review]
More...

AA Sequence

MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET      1 - 70
LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM     71 - 140
EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI    141 - 210
TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY    211 - 280
STSYNMDRFINK                                                              281 - 292
//

Text Mined References (220)

PMID Year Title
26671915 2015 Association between ins4436A in 11?-hydroxysteroid dehydrogenase type 1 gene and essential hypertension in Polish population.
26528718 2015 Metabolic Coupling Determines the Activity: Comparison of 11?-Hydroxysteroid Dehydrogenase 1 and Its Coupling between Liver Parenchymal Cells and Testicular Leydig Cells.
26452272 2015 Association Analysis between the Polymorphisms of HSD11B1 and H6PD and Risk of Polycystic Ovary Syndrome in Chinese Population.
26163245 The expression of 11?-hydroxysteroid dehydrogenase type 1 and 2 in nasal polyp-derived epithelial cells and its possible contribution to glucocorticoid activation in nasal polyp.
25989394 2015 Gender-Specific Differences in Skeletal Muscle 11?-HSD1 Expression Across Healthy Aging.
25788665 2015 The Role of Placental 11-Beta Hydroxysteroid Dehydrogenase Type 1 and Type 2 Methylation on Gene Expression and Infant Birth Weight.
25751397 2015 Impact of HSD11B1 polymorphisms on BMI and components of the metabolic syndrome in patients receiving psychotropic treatments.
25666420 2015 Glucocorticoids and 11?-hydroxysteroid dehydrogenases: mechanisms for hypertension.
25659145 2015 UFSRAT: Ultra-fast Shape Recognition with Atom Types--the discovery of novel bioactive small molecular scaffolds for FKBP12 and 11?HSD1.
25436731 2013 The role and regulation of 11?-hydroxysteroid dehydrogenase type 1 in obesity and the metabolic syndrome.
More...