Property Summary

Ligand Count 2,491
NCBI Gene PubMed Count 228
PubMed Score 890.04
PubTator Score 309.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Peptic Ulcer 27
Ulcer of esophagus 1
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 0.7
Disease Target Count
Cortisone reductase deficiency 2 1

Expression

  Differential Expression (28)

Disease log2 FC p
Obesity 1.100 3.3e-02
adrenocortical adenoma -1.172 3.2e-03
adrenocortical carcinoma -1.578 1.6e-06
astrocytic glioma -1.600 2.1e-02
Atopic dermatitis -3.400 1.1e-05
breast carcinoma -1.500 8.0e-03
ductal carcinoma in situ -1.500 1.2e-02
ependymoma -1.700 3.2e-02
fibroadenoma -2.800 1.3e-02
gastric carcinoma 1.800 1.4e-02
head and neck cancer and chronic obstruc... 1.500 5.0e-03
interstitial cystitis 1.900 1.9e-02
intraductal papillary-mucinous adenoma (... -1.600 1.8e-02
intraductal papillary-mucinous carcinoma... -2.100 6.7e-03
intraductal papillary-mucinous neoplasm ... -1.900 4.9e-02
lung adenocarcinoma -2.100 5.3e-12
lung cancer -1.800 1.6e-03
malignant mesothelioma -8.000 3.7e-10
non-small cell lung cancer -1.012 8.3e-06
osteosarcoma -1.490 3.1e-03
ovarian cancer -1.400 1.9e-07
pancreatic cancer 1.200 9.7e-03
pancreatic ductal adenocarcinoma liver m... -2.777 3.6e-02
Pick disease -1.100 1.7e-02
pituitary cancer -2.500 1.2e-05
psoriasis -2.800 1.0e-06
sarcoidosis 1.700 4.6e-02
ulcerative colitis 1.300 1.9e-03

Protein-protein Interaction (4)

Gene RIF (219)

AA Sequence

MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET      1 - 70
LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM     71 - 140
EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI    141 - 210
TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY    211 - 280
STSYNMDRFINK                                                              281 - 292
//

Text Mined References (238)

PMID Year Title